CAZyme Information: MGYG000004687_00634

Basic Information

• Species: Haemophilus_A parahaemolyticus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Pasteurellaceae; Haemophilus_A; Haemophilus_A parahaemolyticus
• CAZyme ID: MGYG000004687_00634
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351	MGYG000004687_5|CGC2	37968.32	8.2562

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004687	2063107	MAG	China	Asia

• Gene Location: Start: 77598; End: 78653 Strand: -

Full Sequence      

MAKKLLVMAGGTGGHVFPAIAVARELQQQGWEICWLGTKDRMEADLVPKHGIPIEFIQIS
GLKGKGVKALLTAPFAILRAVLQAYKIIKKFKPDAVLGMGGYVSGPGGIAAKLYGVPVIL
HEQNAVAGLTNVWLSKIARRVLQAFPNAFPNAEVVGNPVRQDLFKIEAPEQRFAERDYPI
NILVMGGSQGAQVINQTVPEVAKMLGNQVFISHQVGKGKLAGVEEVYHATGNGVASEFID
DMKAAYEWADLVICRSGALTVCEIAAAGLPAIFVPFQHKDRQQFLNAEYLVEAGAAYVIE
QPEFTPEKLLAVLEPLITDRTKLTEMAIKARVKATPTAAKRVAEVIVEESH

Enzyme Prediction     

No EC number prediction in MGYG000004687_00634.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	182	336	2.3e-51	0.9745222929936306

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	0.0	3	348	2	353	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
TIGR01133	murG	2.34e-154	3	346	1	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
cd03785	GT28_MurG	3.66e-149	4	345	1	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	2.40e-145	3	350	1	355	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
pfam03033	Glyco_transf_28	2.67e-53	5	143	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRP11935.1	2.11e-248	1	351	1	351
QEN10745.1	2.11e-248	1	351	1	351
AWI50761.1	6.19e-225	1	350	1	350
QKJ69504.1	1.25e-224	1	350	1	350
ATW43039.1	2.52e-224	1	350	1	350

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1F0K_A	9.56e-147	3	343	7	347	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
7D1I_A	3.41e-102	3	346	10	362	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
3S2U_A	1.78e-99	1	348	1	353	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8F3B6	4.61e-221	1	350	1	350	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Glaesserella parasuis serovar 5 (strain SH0165) OX=557723 GN=murG PE=3 SV=1
A3MY90	4.02e-215	1	350	1	350	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) OX=416269 GN=murG PE=3 SV=1
B3GZK8	6.65e-214	1	350	1	350	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) OX=537457 GN=murG PE=3 SV=1
B0BRH7	6.65e-214	1	350	1	350	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) OX=434271 GN=murG PE=3 SV=1
Q7U336	7.20e-189	1	350	1	354	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) OX=233412 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004687_00634.