CAZyme Information: MGYG000004687_01909

Basic Information

• Species: Haemophilus_A parahaemolyticus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Pasteurellaceae; Haemophilus_A; Haemophilus_A parahaemolyticus
• CAZyme ID: MGYG000004687_01909
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365		41058.92	9.5689

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004687	2063107	MAG	China	Asia

• Gene Location: Start: 5608; End: 6705 Strand: +

Full Sequence      

MKKHTKYLPLLALIPFLISCGSSPTKHTKRHGSKYHNYDFKDTNGLDILTGQFSHNIDDI
WGSQELLIATKKDYVKYTDQYYTRSHISFEDGVITIETLADQARLKNAIVHTLLMGGDPK
GIDLFASGDTPISANPFLAGQVKDQYGRYVTNAVIANDFANYLVQNATTRRLKNGRNVAV
VQIKMVEGHIEIRARQYLPLVRKMAKRYGIEPSLILGIMEVESAFNPYAVSYANAIGLMQ
IVPKTAGRDIFARKGLNGQPDRAYLYNPEQNIDAGTMYLSILHEEYLDGITNPTSMHYAM
ISAYNSGAGAVLKVFDYDKYEAIDRINELSPDAVYRILTTAHPSAQARNYLKKVSKAREK
YRSVR

Enzyme Prediction     

No EC number prediction in MGYG000004687_01909.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	209	359	4.9e-25	0.8074074074074075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11671	mltC	0.0	1	362	1	357	membrane-bound lytic murein transglycosylase MltC.
cd16893	LT_MltC_MltE	4.48e-87	199	359	1	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
pfam11873	DUF3393	7.78e-76	41	196	3	161	Domain of unknown function (DUF3393). This domain is functionally uncharacterized. This domain is found in bacteria. This presumed domain is typically between 188 to 206 amino acids in length. This domain is found associated with pfam01464.
PRK15470	emtA	3.30e-52	193	357	35	199	membrane-bound lytic murein transglycosylase EmtA.
COG0741	MltE	4.30e-39	56	359	1	296	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEN10923.1	1.03e-262	1	365	1	365
QRP12114.1	1.03e-262	1	365	1	365
AWI50385.1	1.37e-221	1	365	1	364
AWG96153.1	2.05e-214	1	365	1	365
SQF65545.1	2.05e-214	1	365	1	365

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C5F_A	3.86e-117	30	362	3	339	Structureof Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli],4C5F_B Structure of Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli]
4CFO_A	1.10e-116	30	362	3	339	Structureof Lytic Transglycosylase MltC from Escherichia coli in complex with tetrasaccharide at 2.9 A resolution. [Escherichia coli],4CFO_B Structure of Lytic Transglycosylase MltC from Escherichia coli in complex with tetrasaccharide at 2.9 A resolution. [Escherichia coli],4CFP_A Crystal structure of MltC in complex with tetrasaccharide at 2.15 A resolution [Escherichia coli],4CFP_B Crystal structure of MltC in complex with tetrasaccharide at 2.15 A resolution [Escherichia coli],4CHX_A Crystal structure of MltC in complex with disaccharide pentapeptide DHl89 [Escherichia coli],4CHX_B Crystal structure of MltC in complex with disaccharide pentapeptide DHl89 [Escherichia coli]
6GI4_B	2.69e-40	193	357	18	182	Structureof Lytic Transglycosylase MltE mutant S75A from E.coli [Escherichia coli]
2Y8P_A	7.43e-40	193	357	18	182	CrystalStructure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12],2Y8P_B Crystal Structure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12]
3T36_A	9.62e-40	193	357	35	199	Crystalstructure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_B Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_C Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_D Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_E Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],4HJV_A Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_B Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_C Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_D Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_E Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A3N339	4.10e-215	1	365	1	365	Membrane-bound lytic murein transglycosylase C OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) OX=416269 GN=mltC PE=3 SV=1
B0BSH0	4.10e-215	1	365	1	365	Membrane-bound lytic murein transglycosylase C OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) OX=434271 GN=mltC PE=3 SV=1
B3GYW8	4.10e-215	1	365	1	365	Membrane-bound lytic murein transglycosylase C OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) OX=537457 GN=mltC PE=3 SV=1
B8F6F0	1.72e-188	1	365	1	364	Membrane-bound lytic murein transglycosylase C OS=Glaesserella parasuis serovar 5 (strain SH0165) OX=557723 GN=mltC PE=3 SV=1
Q7VKB7	7.79e-188	1	365	1	367	Membrane-bound lytic murein transglycosylase C OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) OX=233412 GN=mltC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000073	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004687_01909.