CAZyme Information: MGYG000004688_01103

Basic Information

• Species: CAG-873 sp900550395
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp900550395
• CAZyme ID: MGYG000004688_01103
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357	MGYG000004688_14|CGC1	39381.96	4.708

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004688	2658373	MAG	Spain	Europe

• Gene Location: Start: 38604; End: 39677 Strand: -

Full Sequence      

MCAIALSSCGGAQKPAESADSTATPAAALLARLQQAVADSTVFFGHHDDTAYGHDWAYAE
GRSDVLETAGKYPGLMNWDLGLIEYGDSIQLDGVPFDFIRHEVRAQAARGGINAISWHPR
NPVSGGDSWDVSASPVPEAVTAGTALNDTLTAWIGRAADFVLSLTDADGNRIPVLFRPWH
EHTGSWFWWGKDFCTPEQYKALWALTRKVFDERGVDNVVWVYSPDKLTSVEEYTERYPGD
EYVDVLGADVYHFGGEEGIEDYLTRARRQLDGAKALSAKNGKIIALSETGSEGLPLADWY
THVLMPLLKEYPVAYVCVWRNASETMKPGHYYVPYKGHAAEADFHKFANDPKIIMAE

Enzyme Prediction     

EC	3.2.1.-	3.2.1.100

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	22	324	6.1e-59	0.9042904290429042

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	6.57e-32	42	251	24	230	Glycosyl hydrolase family 26.
COG4124	ManB2	4.48e-16	172	294	180	300	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD38980.1	2.86e-151	6	357	14	365
QCP72670.1	2.86e-151	6	357	14	365
SCD21901.1	6.34e-112	29	357	46	371
CEA16909.1	5.12e-111	29	357	46	371
QUT33719.1	2.99e-110	6	356	16	364

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZXO_A	9.50e-111	28	355	14	335	Thestructure of a GH26 beta-mannanase from Bacteroides ovatus, BoMan26A. [Bacteroides ovatus]
2VX4_A	9.83e-67	42	357	57	389	CellvibrioJaponicus Mannanase Cjman26c Native Form [Cellvibrio japonicus],2VX6_A CELLVIBRIO JAPONICUS MANNANASE CJMAN26C Gal1Man4-BOUND FORM [Cellvibrio japonicus]
2VX5_A	9.83e-67	42	357	57	389	CellvibrioJaponicus Mannanase Cjman26c Mannose-Bound Form [Cellvibrio japonicus]
4CD4_A	1.80e-66	42	357	80	412	Thestructure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManIFG [Cellvibrio japonicus Ueda107],4CD5_A The structure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManMIm [Cellvibrio japonicus Ueda107]
2VX7_A	7.67e-66	42	357	57	389	CellvibrioJaponicus Mannanase Cjman26c Mannobiose-Bound Form [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49424	2.36e-42	20	334	51	381	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
A1A278	1.52e-33	62	356	84	395	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
O05512	1.76e-21	52	321	66	326	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2
P55278	6.01e-21	110	328	121	328	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis OX=1423 PE=3 SV=1
P49425	4.87e-20	12	291	140	409	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.005357	0.001016	0.993638	0.000002	0.000006	0.000003

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004688_01103.