CAZyme Information: MGYG000004688_01198

Basic Information

• Species: CAG-873 sp900550395
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp900550395
• CAZyme ID: MGYG000004688_01198
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
509	MGYG000004688_16|CGC1	56472.94	9.9579

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004688	2658373	MAG	Spain	Europe

• Gene Location: Start: 26178; End: 27707 Strand: +

Full Sequence      

MKTKQQLALFAAIVIAFLPILILRDFTPSNELRYLSIADEALDGGHIFAFTNHGAPYADK
PPLYLWLVMLGKTVLGHHAMWLLGLFSLIPALVVTWIMGRWTAAELPGHGADAQLMLMTC
GLFAGMAFTLRMDMLMTLWIVLALKTVYDMALSGPTARRQWALGAFTFLALFTKGPLGVL
IPLAGSAVWLLYERRLRDFFRLWGWRSWTVLAGGSALWFLAVWAEGGSEYLNNLLFHQTV
DRAVDAFHHKRPLWYYCTTYWYSLAPWSVLLAAVAGVTAYRRSVSWTSLQRMLWAVSLTT
FVMLSIISSKLAVYLLPAIPFFVYLGAIRLRACYDAWWAKLAVAVPAAALLASPAVLAVM
SRRMPEYGVWGVWAAVVVLSAGAFVAFVLMYGRNRLRAAIRVLAVAVLGALFFGGLAMPQ
LNPYMGYGLLCRETARLRPPHVYVWGLHRPENMDAYLGQPVDIISSPEAITAPGVLLLPT
DSLRSLPFSPDVRGASGPYSIVKISHNQL

Enzyme Prediction     

No EC number prediction in MGYG000004688_01198.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	3	421	5.1e-61	0.7907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	2.93e-22	7	320	11	326	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	2.82e-13	1	317	3	320	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKH86812.1	4.17e-119	13	470	10	475
QTO25703.1	4.17e-119	13	470	10	475
QLK84536.1	4.17e-119	13	470	10	475
QRP88934.1	4.68e-118	13	470	10	475
QUU03965.1	4.68e-118	13	470	10	475

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	7.00e-15	23	390	51	431	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3KCC9	3.06e-16	30	319	49	339	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=arnT1 PE=3 SV=1
Q4K884	1.30e-15	30	327	64	362	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=arnT2 PE=3 SV=1
A8FRR0	3.73e-15	2	317	3	319	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Shewanella sediminis (strain HAW-EB3) OX=425104 GN=arnT PE=3 SV=1
B2VBI7	3.50e-13	23	317	24	319	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99) OX=465817 GN=arnT PE=3 SV=1
A4WAM1	1.90e-12	1	317	1	319	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Enterobacter sp. (strain 638) OX=399742 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998696	0.001317	0.000009	0.000003	0.000002	0.000009

TMHMM  Annotations     

start	end
7	24
77	99
120	142
168	190
202	224
258	280
293	307
311	330
337	359
369	391
398	420