CAZyme Information: MGYG000004688_01365

Basic Information

• Species: CAG-873 sp900550395
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp900550395
• CAZyme ID: MGYG000004688_01365
• CAZy Family: GH127
• CAZyme Description: Non-reducing end beta-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
670	MGYG000004688_19|CGC1	73598.36	6.9538

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004688	2658373	MAG	Spain	Europe

• Gene Location: Start: 44275; End: 46287 Strand: -

Full Sequence      

MKYLYITALTALFSTAPSAATGAEAHGYPINPVSFTSVKVDDPLWSPRLKAARDVTVPLA
FSKCEESGRYENFHKAAHPSADYHVGGFPFDDTDVYKTIEGASYLLQTYPDRRLEAYIDS
VLAIVATAQEPDGYLNTSFTMNPAHPHSWMTPNKRWASVEVLSHEFYNLGHMVEGAVAHY
QATGKRNFLDIAIRYADCVCRNIGDGPGQLTLVPGHQIAEMALAKLYLVTGDRKYLDQAK
FFLDKRGRTERRDMYLQSHKPVTEQDEAVGHAVRAGYMYAGMADVAALTGDTAYIAAIGR
IWDNITGKKLYITGGVGARHEGEAFGANYELPNHTAYCETCAAIANVYVNHRLFLLHGDA
RYYDVLERTLYNGLVSGISLAGDAFFYPNPLASDGAYSRKAWFGCACCPSNLSRFIPSLP
GYVYATDGNKVFVNLYIGNKATIDVQGRKLSLDMHGDYARDGRMKITVAGNRAGNVDLRL
RIPGWAQGAPVPSDLYAYTSGADGKGYSVSVNGTPVDSPLADGYLSISRKWKKGDVVEIA
FDMTPRTVKANDLVEADRGMLAVERGPIVYCAEWTDNPGRDIASALLSMNPEFAVKRTDI
LGGVDMISAKAQFIGLDSDGRLRADVDRLNLIPYYAWANRGEGKMRVWLPASMEGIASAL
REKPYRIGDK

Enzyme Prediction     

No EC number prediction in MGYG000004688_01365.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	38	571	1.6e-202	0.9980916030534351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	37	571	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.11e-165	35	651	9	587	Uncharacterized conserved protein, DUF1680 family [Function unknown].
COG1331	YyaL	0.002	222	370	419	564	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR57394.1	0.0	1	653	1	651
QJR78977.1	0.0	1	653	1	651
AII67308.1	0.0	1	653	1	651
QJR57810.1	0.0	1	653	1	651
ALA73152.1	0.0	1	653	1	651

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	3.23e-314	26	662	3	636	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	1.84e-141	36	649	14	645	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.11e-136	36	649	14	645	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
3WRE_A	1.62e-113	75	648	58	655	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	2.17e-113	75	648	58	655	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	8.85e-113	75	648	58	655	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000385	0.998882	0.000165	0.000201	0.000161	0.000154

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004688_01365.