CAZyme Information: MGYG000004688_02162

Basic Information

• Species: CAG-873 sp900550395
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp900550395
• CAZyme ID: MGYG000004688_02162
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
847	MGYG000004688_54|CGC1	95624.67	5.1681

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004688	2658373	MAG	Spain	Europe

• Gene Location: Start: 7946; End: 10489 Strand: -

Full Sequence      

MPMRWLKVIFASVVLSCPYLEAFEIVDGAGRAASVVVSDTDWKGVARAADDFAADVERVS
SVRPSVVRGLRGRGSVVAGTIGKSDIIDSLVAAGRINVDSVRGRWESYVIEEVDGNLVVA
GADKRGTIYGIYTLSEEIGVSPWYYMADVQPRRHDGRLTVESRRRVQPSPAVKYRGIFIN
DEEPSFGSWARNKFGGYNSSMYSHIFELLLRLKANYMWPAMWSSSFNEDDPLSPAMADEY
GIVMGTSHHEPMMRNHNEYVRRREQIGPWNFDTNSERVSRFFREGMERNRDYEQVVTIGM
RGDGDVGLEGGDEAAVRTLGRVVDAERAILSDIYGRADSVPQLWAIFTEVQRYYDRGFTV
PDDVTLLFCDNNWGYIRRTGPEKERGRRGGMGLYYHIDMNGGPWNDRWVNTSPVAKLRNQ
FELAYRSGLDRLWVVNVGDLKPKEVAIDFIMRYAWDPDAFPAGCEADFHTQFAESVFGPE
VAAAAGDIIRRYTKYNLWRKPEVQNVPWFSVENHGEAMRLMDLWTRLEADAEALRSSIPA
GLDDAYYQLVYYPAVASAGVARMYLNAALYNYTGDDRYADETRRLFERDKVLSDYYNNTM
AAGKWNGMMQDRHIGYERWFMPDSNRMPELVAPEIRRPLQGACTPTPEIAIEACAYTRKT
DGRDNGWQFLPDLGRGRGCMGARDVVMPFSGRLADCAVLEYEIPHGLFGDSVVLAIGTLP
VQDVNPARGLRIAVAVDDSEPLMLDARQGLHDEFGEYTPENLRRNPRMSAPAPKDASLYL
TGSGGHLRTEVFDNMRWLTARMPLRSASSEHSVKLYLVDPEVVVEQININPDSEHPSYFG
APFNNKP

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	29	827	6.9e-227	0.9870875179340028

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	3.07e-178	169	503	2	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	1.20e-17	649	842	9	171	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	0.009	62	134	50	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ50360.1	3.29e-299	20	842	15	964
EEC55419.1	7.58e-299	20	842	40	989
QRQ59056.1	2.18e-280	8	842	6	976
ALJ47135.1	4.94e-280	8	842	31	1001
SCV06546.1	5.63e-280	8	842	35	1005

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZMH_A	7.33e-173	33	628	23	629	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
7PUG_A	9.68e-159	21	762	15	772	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	3.14e-156	21	762	14	771	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4C90_A	4.77e-156	30	781	50	819	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
6NPS_A	4.45e-122	44	630	31	655	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000653	0.578382	0.420293	0.000226	0.000227	0.000206

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004688_02162.