CAZyme Information: MGYG000004693_00592

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UMGS1375
• CAZyme ID: MGYG000004693_00592
• CAZy Family: GH5
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362		41271.71	4.5733

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004693	1958211	MAG	Sweden	Europe

• Gene Location: Start: 249; End: 1337 Strand: +

Full Sequence      

MEKNRKTKKVIAVLLMLILVIFAVALAEYAMISRSYEENRKLRTAQKDNEQGENLAAVEN
KENESLDGIKVHGQLLVKGTQLTDASGNPVQLRGMSSHGILWYPEYSNFASLCETKKYGA
NMFRIAMYADDVDDGYVQQPTLSKKLVCQAIENALAADMYVIVDWHTLKEENPLKNVLQA
KEFFEEISVRYAKEPGILYEICNEPNGDTTWEQIREYAEQVIPVIREHAPDAVILVGTPD
YSYSITKVEPLSYENLMYSYHFYAGQYDDAYKNMIEDTQRKGIPVFVTEWGINEEQGGEA
ALTQGKAFAEYLNEKKISFAAWSLCNKEETFSALRPDCGTYRDWEEKDFTEVGRILFEAL
KG

Enzyme Prediction     

EC	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	86	320	1e-73	0.9873417721518988

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.18e-57	84	327	2	271	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	2.09e-12	73	324	45	359	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJA08944.1	4.69e-98	68	360	44	338
QQR30621.1	9.31e-80	68	358	225	517
ANU55408.1	9.31e-80	68	358	225	517
ASB41357.1	9.31e-80	68	358	225	517
CBK95395.1	1.99e-77	69	361	271	569

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GJF_A	1.58e-82	69	361	7	301	Ancestralendocellulase Cel5A [synthetic construct],6GJF_B Ancestral endocellulase Cel5A [synthetic construct],6GJF_C Ancestral endocellulase Cel5A [synthetic construct],6GJF_D Ancestral endocellulase Cel5A [synthetic construct],6GJF_E Ancestral endocellulase Cel5A [synthetic construct],6GJF_F Ancestral endocellulase Cel5A [synthetic construct]
4XZW_A	1.42e-74	69	361	6	307	Endo-glucanasechimera C10 [uncultured bacterium]
3PZT_A	3.06e-74	69	362	31	326	Structureof the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZT_B Structure of the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZU_A P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZU_B P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_A C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_B C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_C C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_D C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168]
4XZB_A	7.34e-72	69	361	6	308	endo-glucanaseGsCelA P1 [Geobacillus sp. 70PC53]
1A3H_A	9.55e-69	69	361	3	298	EndoglucanaseCel5a From Bacillus Agaradherans At 1.6a Resolution [Salipaludibacillus agaradhaerens],2A3H_A Cellobiose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 2.0 A Resolution [Salipaludibacillus agaradhaerens],3A3H_A Cellotriose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 1.6 A Resolution [Salipaludibacillus agaradhaerens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15704	2.29e-73	73	362	45	337	Endoglucanase OS=Clostridium saccharobutylicum OX=169679 GN=eglA PE=3 SV=1
P07983	9.13e-72	69	362	36	331	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=2
P10475	1.81e-71	69	362	36	331	Endoglucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=eglS PE=1 SV=1
P22541	1.45e-69	69	360	110	407	Endoglucanase A OS=Butyrivibrio fibrisolvens OX=831 GN=celA PE=1 SV=1
P23549	1.17e-68	69	362	36	331	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.703210	0.284517	0.003753	0.001781	0.000862	0.005884

TMHMM  Annotations     

start	end
13	32