CAZyme Information: MGYG000004693_00593

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UMGS1375
• CAZyme ID: MGYG000004693_00593
• CAZy Family: GT2
• CAZyme Description: Cellulose synthase catalytic subunit [UDP-forming]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
648		75080.65	9.5015

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004693	1958211	MAG	Sweden	Europe

• Gene Location: Start: 1344; End: 3290 Strand: +

Full Sequence      

MGETMRKEKKGKRKKGKEAKSTGWNKFFVVLTMIFTLNYLVWRIFFTMPQQHGKWSVVMW
AILLVAECAGLLEMAVHFYNMYNYDQMELVMPKMAKADFPEVDVFVPTVNEERSLLEKTL
YACKRMEYPQKEKVHIYLCDDGNRTEIKELAEKLGVFYLAREEHQDAKAGNLNDALAHSK
SPYIVVFDADMMPKKDFLMKTIPWFAKEKTGFVQTPQNFYHPDLFQYNLYAQDKIPNEQD
YFYRVVQVAKNKSNSVIFGGSNAVLSRKALEEIGGFVTGVVTEDFATGIEIEKKGYRGIA
IPDVLASGMPPATFQELIGQRRRWAKGCIQSGRKTGFLFSGSLKFWQKINYLTAISYWYT
PLKRLIYFLAPLLFAFFGIMIVKCRFYQIFLFWLPMYVTANICMRRFSRNIRTTKWTDVY
ETVFAPWLLPTVLLAGIRKKGTFRITDKKTEQGKNSSFGYALPYLAGMLLCMIAIVRLVG
LSAREQTLTYSVILFWLCLNLYFQLLACYVAVGRERKADYTMQALAMQGSLKGEKEICTV
TCEGFSDTAVLLKRKGGMREQKGELILERSNLVLPIFRKETPGEQQESETTEEKAYIFQI
DPSRWQERQKQSYLEFLYDRAPLLPQQLQRKGHLDESVTALFYHLTEV

Enzyme Prediction     

No EC number prediction in MGYG000004693_00593.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	103	274	8e-29	0.9941176470588236

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06421	CESA_CelA_like	1.41e-99	100	330	1	232	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
PRK11498	bcsA	1.15e-87	29	571	190	740	cellulose synthase catalytic subunit; Provisional
COG1215	BcsA	5.27e-52	46	400	5	354	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06437	CESA_CaSu_A2	1.46e-38	100	327	1	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
cd06435	CESA_NdvC_like	2.10e-33	106	334	4	234	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLG36835.1	8.54e-177	25	642	8	624
AWB45609.1	6.01e-173	25	639	21	627
QKS58548.1	9.41e-173	25	642	8	623
BBF45458.1	1.05e-169	33	639	10	610
AYD22186.1	7.19e-169	26	636	7	632

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	1.82e-75	29	569	203	751	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	4.53e-68	37	472	66	520	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.42e-67	37	472	78	532	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	1.44e-67	37	472	79	533	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
6YV7_B	1.60e-17	100	305	42	243	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q93IN2	1.81e-78	29	569	203	751	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsA PE=3 SV=1
Q8Z291	2.51e-78	29	569	203	751	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhi OX=90370 GN=bcsA PE=3 SV=1
Q8X5L7	4.27e-75	29	569	203	751	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 OX=83334 GN=bcsA PE=3 SV=2
P37653	8.16e-75	29	569	203	751	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) OX=83333 GN=bcsA PE=1 SV=3
P58931	1.71e-71	29	570	89	638	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
21	42
57	79
365	382
386	403
458	480
490	512