CAZyme Information: MGYG000004697_02188

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eubacterium_F
• CAZyme ID: MGYG000004697_02188
• CAZy Family: GT2
• CAZyme Description: Teichoic acid poly(glycerol phosphate) polymerase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
394	MGYG000004697_47|CGC1	47766.69	6.5066

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004697	2635939	MAG	Spain	Europe

• Gene Location: Start: 2941; End: 4125 Strand: -

Full Sequence      

MRTVIRYIVKKLVILLYRIMCAIIPVNKKRIVFDSSLGKSYSGNPRHIFEYMVENGYQEK
WECTWFYENEPYPIPGDGYQFRYGRLRYLYYMATAKVWVFDCRQPEWLIKRKGCYYIQTW
HGTPLKKLVLDMEDVFMVNETDIESYQKGFVKNVQSWDYLISQNPFSTTTFRRAFDFNKC
MLEIGYPRNDILFKKNNEEDIVRLKRRLGLPLDKKILLYAPTFRDDEFNENSSYKFSPKL
SFQKLKEELQDEYILIVKYHYLIMDYIDWFQHKGFIYHFDQSNDIAELFLVSDMLITDYS
SVMFDYSILHRPMFFYAYDLDKYKNDLRGFYFDYRGEMPGPISTDTEELIRDIKQYNASE
YEERYENFRKKYNCWDDGNASAKVVETIEELLKS

Enzyme Prediction     

No EC number prediction in MGYG000004697_02188.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04464	Glyphos_transf	2.02e-123	25	390	1	360	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
COG1887	TagB	9.57e-88	1	391	7	387	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQZ10349.1	5.70e-117	10	388	329	703
QOV10415.1	2.44e-116	25	388	347	706
QHS23522.1	8.37e-114	13	388	333	708
CUH93585.1	4.00e-111	25	388	431	791
AWC30558.1	1.07e-107	16	384	335	704

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3L7I_A	1.77e-91	26	393	350	719	Structureof the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_B Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_C Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_D Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A]
3L7J_A	1.90e-90	26	393	350	719	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
3L7M_A	5.25e-90	26	393	350	719	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8RKI5	2.11e-108	10	388	10	392	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarF PE=1 SV=1
P13485	2.40e-105	20	388	373	742	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagF PE=1 SV=1
Q2G1C1	1.76e-100	27	388	26	387	Teichoic acid glycerol-phosphate transferase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=tarF PE=1 SV=1
Q5HLM5	8.18e-91	26	393	350	719	Teichoic acid poly(glycerol phosphate) polymerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=tagF PE=1 SV=1
P27621	3.64e-34	86	392	89	380	Teichoic acid glycerol-phosphate primase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.964742	0.032330	0.002706	0.000076	0.000044	0.000101

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004697_02188.