CAZyme Information: MGYG000004698_00126

Basic Information

• Species: Prevotella sp000436695
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp000436695
• CAZyme ID: MGYG000004698_00126
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374	MGYG000004698_2|CGC2	42608.24	7.4079

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004698	3424026	MAG	Denmark	Europe

• Gene Location: Start: 65730; End: 66854 Strand: +

Full Sequence      

MKLLNRFIFAGVLLAAALPALAGSKADKVIKTIYKVNSHWQKNHTDPGTAFWHNAAYHTG
NMEAWKLTGNKAYYDYSEKWAEHNKWMGARGNDPSKWKYSYGETDDYVLFGDWQVCFQTY
ADLYTAKPDEAKIARARQVMEYEMSTKNNDYWWWADGLYMVMPVMTKLYKITGNTLYLDK
LYEYWTYADNLMYDADSRLYYRDAKYIYPKHKTNSGKKDFWARGNGWVLAALAKVLQDLP
EDNAHRQAYINRYKAMAEAVAKCQQDGGYWTRSMLDADFAPGCETSGTAFFTYALLWGIN
NGMLDAKTYAPVALKGWKYLSEVALQADGSVGYVQPIGERAIPGQVVSAESTADFGVGAF
LLAACEMARYCESH

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	43	369	9.4e-80	0.9819277108433735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	7.90e-92	32	370	1	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.22e-47	42	369	31	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT64861.1	1.28e-194	25	370	26	371
QQA30832.1	1.28e-194	25	370	26	371
QUT33910.1	1.28e-194	25	370	26	371
QUT62329.1	1.28e-194	25	370	26	371
AVM52622.1	3.54e-194	7	370	13	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	1.17e-188	1	373	1	377	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	3.43e-154	26	372	13	359	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	1.17e-54	27	369	26	368	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
1NC5_A	3.42e-18	52	367	41	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.43e-17	52	367	31	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	7.62e-54	27	369	33	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	7.62e-54	1	369	6	374	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	1.12e-41	152	367	199	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	1.87e-17	52	367	41	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000301	0.999010	0.000193	0.000174	0.000155	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004698_00126.