CAZyme Information: MGYG000004698_01003

Basic Information

• Species: Prevotella sp000436695
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp000436695
• CAZyme ID: MGYG000004698_01003
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
992	MGYG000004698_22|CGC1	112002.33	8.1473

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004698	3424026	MAG	Denmark	Europe

• Gene Location: Start: 3376; End: 6354 Strand: +

Full Sequence      

MLGKKSLKTLFATLFLAISTTTNANDTTPVSTKYLSNVPQYISYEKGQGAFCIAENGITA
NICVSSSDYEGVRRAAADLGDDIRKVTGTAAKVTVTDKAAKGAIIVGTIGKSKLIDKLIR
NKKLDVTGIEGKWESFVIQTIGNNLVVAGSDKRGTIYGIYDISEKIGVSPWYWWADVPAR
KSSRLYVSQGRYVQPSPKVKYRGIFINDEWPSFGGWAKARFGGINSDMYVHMFELLLRLK
ANFLWPAMWDSAFNEDDPRCPELADMYGIVMGTSHHEPMMRAHKEYTRRREKIGPWDYNV
NKANLDKFFSYGIERNKNYDNMITIGMRGDGDVAMGKGDDEANMKTLSEVIASQRNIISK
IYGKDAKDVPQLWAIFTEVQRYYDKGFNVPDDVLLLFCDNNWGYIRRTGPERERNRKGGM
GLYYHVDMNGGPWNDRWVNTTTVPKMREQLGLAYKTGIDDLWVINVGDLKPKEIPIDFIM
RYAWNPDAITADDTYKYTTAWAAQNFGDSFASDIAYIVSRYPKYNLWRKAEVQRPGIFSV
ANYHETERVDSLWQELKTKAIALRRQIPKEYDDAFFQLVYYPAVASAGVAQMFTAATRNN
VYAAQQRPLANRCAETARKLFEEDSCLTRYYNDTLANGKWKNMMSDKHIGYIHWYMPERD
SLPQLLTIMPLAKPCMGVNIEGSIKAEAKDTLPTFDVLLDQEYYIDIFNRGNNSFKFTAK
ADKPWVKLSKSSGNVTTEERIMASVDWTKLDNGRHSATITISDGKSSSQITVNAVKAERP
ETTEPFYGNFAGNEFSVPAYGYSNNVKGTKVSWTMLPDLGRSEGCMGADDVTAKISETDK
AAQLEYNVLLPDTDSVTVCIGILPTQDINPERGLRLAIGLDDNSPITIDARQGLVDTFDE
YTPQNLAMSKNLKPLPKPATNIRLTGYGEFMRNEVFDNIRWLTTRLHINKGGLHKLKIYM
VDPEIVLERIVINPDNSHPSYFGAPEKKMALQ

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	49	714	3.7e-245	0.8981348637015782

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	196	532	2	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	7.91e-37	796	986	10	172	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	1.22e-04	75	161	36	119	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).
cd14948	BACON	0.001	717	773	28	81	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
pfam19190	BACON_2	0.002	709	772	24	86	Viral BACON domain. This family represents a distinct class of BACON domains found in crAss-like phages, the most common viral family in the human gut, in which they are found in tail fiber genes. This suggests they may play a role in phage-host interactions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDW23484.1	0.0	35	985	29	983
EEC55419.1	0.0	60	991	53	995
QRQ50360.1	0.0	60	991	28	970
QRQ59056.1	0.0	38	989	2	980
SCV06546.1	0.0	38	989	31	1009

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZMH_A	4.45e-231	41	983	5	929	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
4C90_A	3.10e-173	40	682	33	679	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	1.15e-168	42	668	7	650	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	5.18e-166	42	668	6	649	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
6NPS_A	2.19e-151	71	986	31	962	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000268	0.999104	0.000172	0.000158	0.000147	0.000136

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004698_01003.