CAZyme Information: MGYG000004698_01815

Basic Information

• Species: Prevotella sp000436695
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp000436695
• CAZyme ID: MGYG000004698_01815
• CAZy Family: GH141
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
596	MGYG000004698_59|CGC1	65823.03	5.7923

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004698	3424026	MAG	Denmark	Europe

• Gene Location: Start: 5235; End: 7025 Strand: -

Full Sequence      

MKKLFITAIISLCCNLTAPAGDIFVSATNGNDKASGSKEAPLKTLEQALKQAREWRRLGS
SNAEGGISIIMSGGVYRLYKPLFIRPEDSGTANSPTIIRSADGERAVISGGIEVKGWRKG
CDDPRLPAEVRSKVWVADAPMDGNRIVETRQLWADGHKAMRASQFAYGIMERMKAFNTDD
ESITIPTPKTDLSRARQLEMTVHQRWAIAILRVKEMKDLGNGLTKVWFHQPESQIEFAHP
WPQPVIDGDKGSSSFCLTNAAELLDEPGEWFQDYPSGRIYYYPEDGKDPNRMDITVPLLE
TLMNIGGTRERHVSNIRFENIAFEHSAWRRPLHEGHVTLQGGFRFIDGYKLAEPGLPHKA
ELENQAWIARPEAAVTAQFADSIGFSSCTFSHIGATAVDLAYAVSSSDISSCVFTDIGGT
AIMAGWFGEQGFETHIPYKPAIDSDMCNRLIIARNTITDAANEDWGCGAVSAGYVRDTDI
SGNTISHVNYSGICVGWGWTAHESGMRNNRITDNSISDYARQLYDVGGIYVMSNQPGSVI
SGNTISMPYPAPYATNDRAFCIYFDEATDGYTVSNNKMPEESYGYNKPGKNLRIIR

Enzyme Prediction     

No EC number prediction in MGYG000004698_01815.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH141	23	580	8.6e-187	0.9905123339658444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13229	Beta_helix	9.50e-10	385	577	13	157	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	1.08e-07	400	577	4	133	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam05048	NosD	6.19e-05	455	576	52	147	Periplasmic copper-binding protein (NosD). NosD is a periplasmic protein which is thought to insert copper into the exported reductase apoenzyme (NosZ). This region forms a parallel beta helix domain.
pfam05048	NosD	1.16e-04	442	544	88	171	Periplasmic copper-binding protein (NosD). NosD is a periplasmic protein which is thought to insert copper into the exported reductase apoenzyme (NosZ). This region forms a parallel beta helix domain.
pfam13229	Beta_helix	4.56e-04	468	578	1	87	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD42515.1	4.87e-265	5	594	3	595
QJR76527.1	3.57e-251	1	589	1	588
AII69040.1	7.69e-250	2	589	4	588
QUT84057.1	7.69e-250	2	589	4	588
ALA74807.1	2.29e-249	2	589	35	619

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQP_A	2.36e-151	20	589	24	593	Glycosidehydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_B Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_C Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_D Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_E Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_F Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_G Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_H Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000429	0.998801	0.000269	0.000164	0.000160	0.000154

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004698_01815.