CAZyme Information: MGYG000004700_01471

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Gemmiger
• CAZyme ID: MGYG000004700_01471
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328		35892.21	4.6756

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004700	2043813	MAG	Spain	Europe

• Gene Location: Start: 1931; End: 2917 Strand: -

Full Sequence      

MSPETIQNDGPNGIYSYTLGQYANTDTSSGDPCAVDPEDPNLNYKMGVMPSETVIGSTFS
KQLAAEYGRVVGNYSLWSNLTIHWGCGTNLHRVPYNSRNHEYYSEDAVLTAGQGTAYVAA
AKEYGCIEAPKHLAFNDTEVNRTGVAVFMTEQQARENELRGVQAIIEDAGALGVMTAYNR
VGCYTSNSHTGLMINILRGEWGFQGLMSEDFIQDANYTALKEAVMNGITMSCNTGDSTME
AVSEKWPYWTVENVSQDATLMAALKQVMLWQNYALANSNAMDGLSSTSRLVSVRTWYDNA
LTGVQIAFALLTLAGVAMYIRAAKRKKS

Enzyme Prediction     

No EC number prediction in MGYG000004700_01471.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	41	232	3.7e-36	0.8935185185185185

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.46e-15	50	211	84	250	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.58e-14	47	245	86	298	Glycosyl hydrolase family 3 N terminal domain.
PRK15098	PRK15098	2.06e-08	57	228	128	299	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT30388.1	1.90e-168	1	328	708	1035
QHB24155.1	1.90e-168	1	328	708	1035
QEI31656.1	1.90e-168	1	328	708	1035
CBL22609.1	3.66e-158	2	327	695	1020
QOL32819.1	1.33e-78	6	325	691	1009

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2X40_A	2.27e-23	38	244	70	285	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	7.53e-23	38	244	70	285	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
5WUG_A	3.77e-22	30	243	562	799	Expression,characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii],5WVP_A Expression, characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
4I3G_A	1.73e-20	3	224	93	288	CrystalStructure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]
5WAB_A	2.60e-18	3	226	38	248	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5AV15	3.29e-22	49	211	93	255	Probable beta-glucosidase J OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglJ PE=3 SV=1
P16084	3.57e-21	40	245	599	803	Beta-glucosidase A OS=Butyrivibrio fibrisolvens OX=831 GN=bglA PE=3 SV=1
P15885	2.25e-20	33	242	517	737	Beta-glucosidase OS=Ruminococcus albus OX=1264 PE=3 SV=1
B0Y8M8	7.16e-20	49	211	72	234	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2
Q4WLY1	7.16e-20	49	211	72	234	Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglJ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
301	323