CAZyme Information: MGYG000004700_01675

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Gemmiger
• CAZyme ID: MGYG000004700_01675
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
621		70614.22	5.8347

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004700	2043813	MAG	Spain	Europe

• Gene Location: Start: 158; End: 2023 Strand: -

Full Sequence      

MQTDATWQAIQDTGRRIVSENPFFAPLQIYESCTPCKEISGWTAPGFLCTWPNAVEYDLL
DLSPVLYVSALKPRPIPFLRRTRREFAGQAVPFRVGPYSTVSVVLDAGELTTGYLFLRLA
GGAGAGVELLQAECYLKKVPLHYDNYRDHPEKGDRTDASGILAGYADHYTVLGTGTESRP
EEYEPFWFRTFRYLKLSITTKAEPLAVLGLDYEETGYPLEVQTQVETSDPEMHRIWEISE
RSLRRCMHETYEDCPYYEQMQYAMDSRSQILFTYATAADDRLARQCMEAFRRSVRPNGLL
NASYPNIGNNIIPGFSVYYIGMLYDHMMYFGDAALLCRHLPTVDGILSYFHNHLTPQGLV
DKIGDIDAPHPQWSFIDWAEEWDATRGVPPATLQGPLTMESLLYLLGLQYAVAICRYLGQ
GQTAQRYQSRADALRQAINRCCRNPDGIYRDGPQVQQFSQHCQVFAVLTGTCTPEEGRAN
LLQTLKHPEQYAQCSVAMMPYLFRALEQCDLYEQTQALWSPWRKMLQYHLTTCAEDLIRQ
RSDCHAWGALALYELPSVVLGVRPAAPGYAKVSVHPHPAQFRWAKGTVITPRGKVFVEWH
KKDDETLEVKVSADNDNIIFC

Enzyme Prediction     

No EC number prediction in MGYG000004700_01675.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	102	612	3.2e-105	0.9662698412698413

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	3.68e-14	213	470	1	236	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	4.66e-08	561	611	1	53	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCN31128.1	1.45e-202	4	605	133	750
AIW40053.1	5.16e-192	1	613	132	761
QBZ22885.1	1.76e-188	1	604	87	710
QAR90756.1	7.05e-188	1	604	87	710
AGE39181.1	7.05e-188	1	604	87	710

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	2.42e-44	103	616	439	934	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
6I60_A	7.79e-08	37	604	309	880	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999925	0.000086	0.000001	0.000000	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004700_01675.