CAZyme Information: MGYG000004701_00471

Basic Information

• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Desulfovibrio
• CAZyme ID: MGYG000004701_00471
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
227	MGYG000004701_41|CGC1	25090.58	11.5578

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004701	2483824	MAG	China	Asia

• Gene Location: Start: 1948; End: 2631 Strand: -

Full Sequence      

MKDLSNPAVAFPRQALRAALLGVGFLLASTWLPIQAKAADVTIPRAARQYRATLVRAAHA
SWGLDAPVSVFAAQVHTESWWRNETVSHVGAQGLAQFMPATARWLPSVAPETGRPAPFNP
GWSLRALCVYDKWLWDRTNGANAFERMAFTLSAYNGGLGWVNRDKAKARRQGADARRWFG
AVETVNAGRSAAAWKENRQYPRRILKERQHTYIKAGWGPGVTEGGRP

Enzyme Prediction     

No EC number prediction in MGYG000004701_00471.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	4.05e-21	72	185	16	123	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13399	Slt35-like	7.61e-15	67	159	4	96	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
cd16896	LT_Slt70-like	1.64e-13	50	206	4	142	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00254	LT-like	2.82e-12	71	209	4	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	1.08e-09	67	175	11	113	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SFV72330.1	1.00e-114	36	226	10	200
SFV71937.1	9.14e-97	68	226	1	159
ADU63417.1	2.79e-79	43	221	21	199
AAS95608.1	1.54e-78	26	226	20	219
ADP86211.1	1.54e-78	26	226	20	219

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000588	0.998578	0.000241	0.000218	0.000178	0.000153

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004701_00471.