CAZyme Information: MGYG000004701_01083

Basic Information

• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Desulfovibrio
• CAZyme ID: MGYG000004701_01083
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
797		87636.5	7.312

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004701	2483824	MAG	China	Asia

• Gene Location: Start: 3730; End: 6123 Strand: +

Full Sequence      

MSGIACSAIVAMLFFWASRDLPDLSRLEDYHPPQATTILARDGSILGTLYHEKRFIITLE
DMPKYLPLAFLAAEDDNFYRHSGVDPVAIARAAFVNITSGSKRQGGSTITQQVIKQLLLT
SERSYTRKMKEAILAYQLENTLSKDQILLTYLNYIYLGQHAYGVEAAARTYFGKHAADIT
LAEAAVIAGLPQAPSRYNPFRHPDEAKKRQMYVLSRMRALQWISEAQYQQASNEPLIYWS
MPDYRPGAAQWYQEEARRLLVEFFTEKNLAALGVRTNKSGEDYVYEAGLTVRTSMDPVQQ
DAAGAALRRGLEELDKRQGWRGSIGKLTPEEQKAFLDESTFDPLSLVGDVWVKALVTRSE
AKQLTVALGQGYTGVIPLANMSWARKPNPRVAGMHAPAIRDARAVAEAGDLIWVSAAPLL
VQEGKKKQEVAYDPARVQKKTPIVLRLQQEPLAQGALASIEPQSGDVVALIGGYQFGNSH
FNRATQARRQPGSSFKPVVYSAALDAGFTPTSQVLDGPLVYVNPYTNEVWRPSNYEHNYK
GILPLHTALALSRNTTTVRVAQTIGIANVIQRAKMLGLEPDFPQELAVSLGAVAVSPLNL
TQAYAAFANQGLGVRPRIITSIVDARGRELYRQDVEHWQAITPQNAYQMACLLREVVNAG
TGSRARVPGHDNIGGKTGTTNEECDTWFVGFSPYLVTGVYVGFDQVRSLGRLEQGGRTAA
PIFRYYRTAVEDLYKEYPQDFVMPPGITMEGNLAFNGPAQPGLSAVDGATPTDPATATGA
IGADTSEGGEDLMRQMF

Enzyme Prediction     

No EC number prediction in MGYG000004701_01083.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	42	218	7.4e-71	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	0.0	53	730	1	528	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG5009	MrcA	0.0	8	749	21	735	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
COG0744	MrcB	3.01e-174	4	789	25	652	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	2.65e-132	21	790	33	845	penicillin-binding protein 1a; Provisional
TIGR02071	PBP_1b	3.93e-97	8	751	102	699	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMD90698.1	0.0	3	797	22	812
SFV73272.1	0.0	3	797	18	820
QTO40729.1	0.0	3	797	22	812
QCC86511.1	0.0	3	797	22	812
VZH33101.1	0.0	10	797	29	812

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OON_A	2.35e-131	38	747	23	737	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3UDF_A	3.60e-115	38	723	23	708	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]
5U2G_A	3.01e-99	17	757	3	788	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
7U4H_A	7.68e-67	34	705	19	737	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
3NB6_A	7.11e-58	43	234	9	200	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O87626	1.60e-137	9	726	23	700	Penicillin-binding protein 1A OS=Neisseria flavescens OX=484 GN=mrcA PE=3 SV=1
Q5FAC7	2.63e-135	9	747	23	720	Penicillin-binding protein 1A OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) OX=242231 GN=mrcA PE=3 SV=3
O05131	2.63e-135	9	747	23	720	Penicillin-binding protein 1A OS=Neisseria gonorrhoeae OX=485 GN=mrcA PE=1 SV=3
O87579	2.63e-135	21	726	35	701	Penicillin-binding protein 1A OS=Neisseria lactamica OX=486 GN=mrcA PE=3 SV=1
P0A0Z6	2.19e-133	9	747	23	720	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998526	0.001453	0.000027	0.000004	0.000003	0.000005

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004701_01083.