CAZyme Information: MGYG000004703_00335

Basic Information

• Species: Prevotella sp900556275
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900556275
• CAZyme ID: MGYG000004703_00335
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
827	MGYG000004703_5|CGC1	92791.33	6.5841

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004703	2398084	MAG	China	Asia

• Gene Location: Start: 54635; End: 57118 Strand: -

Full Sequence      

MKINILTPVVGALALMAGGSTQKNKSEADLLHQIPFQKVTLKDNFWRPRLVTQKETLVPF
ALDKVRPAMDNLRKTGNYLKGDKSELPFPHRFVASDLYKVMEGAAYLLTLEKDPRLEHTM
DSIIDLIGSAQQADGYLYESHTTGVSANHEHWGGAGMGDKPYSWVVHSHELYNMGHMYEG
AVAYYQATGKDKWLKIAEKNARHVNHVFFEGDPNYNGGRPVRQAPGHEEIELALVKMYQA
TGDTLYLGMAKRFIDIRGVSFRPEGDGVMSPEYAQQHAPVRYQRKAVGHAVRAVYLYSGM
ADVMAQTGDITLKPALDSIWSNIVDTRMHITGGLGAIHGIEGFGPEYVLPNMDAYNETCA
AVGNVMFNYRMFMAEKDAKYIDVAEVSLYNNVLAGVNLEGNKFFYVNPLETNGRKAFNQG
VKGRSPWFGTACCPSNIARLLPQIPGMMYAYTDNDIYCAFYGGTSTVVPLKKGNVEIRQT
TEYPFDENIRFEIRPEHASQTFALRLRIPTWIGRQFVPGKLYDYVNDRPAEWKVRVNGVE
TRAELVKGFAVIDREWKAGDRVELSLPMDVRYNKAIDKVEADRGRLCITRGPLVYCAETA
DNASAPASYVIPVSNGNVISKKGSGLLGNIDFITIPAHSVQNEADKTVTLLPYYAWDNRG
DDAMTVWMADNDKTALDALPTLPDFVADVKATHTYNEDDVFAMLTNKYPASSHDTSMPRW
TSWPQTGKAQTVELTLKRAINLQSLSVYWYDDNGGVQVPEAWTMQYRQDGRWHDFPIYVT
DEYRSLKDQYNMVHPGNDIRPDALRIIITPKKDAAAGILSVQIEEVK

Enzyme Prediction     

No EC number prediction in MGYG000004703_00335.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	39	596	5.2e-178	0.9980916030534351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	3.57e-149	39	596	2	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.50e-142	24	669	2	586	Uncharacterized conserved protein, DUF1680 family [Function unknown].
COG1331	YyaL	9.83e-06	181	281	419	524	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
cd04791	LanC_SerThrkinase	6.13e-04	184	344	98	252	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.
cd00249	AGE	7.82e-04	173	276	175	299	AGE domain; N-acyl-D-glucosamine 2-epimerase domain; Responsible for intermediate epimerization during biosynthesis of N-acetylneuraminic acid. Catalytic mechanism is believed to be via nucleotide elimination and readdition and is ATP modulated. AGE is structurally and mechanistically distinct from the other four types of epimerases. The AGE domain monomer is composed of an alpha(6)/alpha(6)-barrel, the structure of which is also found in glucoamylase and cellulase. The active form is a homodimer. The alignment also contains subtype III mannose 6-phosphate isomerases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SCD19473.1	0.0	29	827	25	824
AIA99612.1	0.0	23	824	24	827
QWG09265.1	5.87e-308	6	823	12	844
QJE94520.1	7.70e-303	1	824	1	819
BBO34810.1	5.05e-300	36	821	32	822

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	2.56e-160	34	668	10	623	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	4.81e-119	39	668	16	645	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	4.80e-114	39	668	16	645	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	9.93e-98	9	668	15	694	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
3WRE_A	1.08e-95	39	667	3	655	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	5.89e-95	39	667	3	655	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000379	0.103940	0.895468	0.000072	0.000084	0.000051

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004703_00335.