CAZyme Information: MGYG000004703_00824

Basic Information

• Species: Prevotella sp900556275
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900556275
• CAZyme ID: MGYG000004703_00824
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1483	MGYG000004703_19|CGC1	166153.59	4.8809

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004703	2398084	MAG	China	Asia

• Gene Location: Start: 17154; End: 21605 Strand: +

Full Sequence      

MKRIFTLFVAVVSAMTVFAQSAELFKPYQPIDLRLPSVPIIVNDPYFSIWSPYDKLTDGS
TRHWTDAQKAIDGLLRVDGTTYRFMGVERPYVLQSIMAMADEGAWTARTSRRNPGTGWAD
TDFDDSQWATERGAFGTPNEYPNVNTSWTAENSDVYARRTVTLTAEDIASDLYVVYSHDD
VFELYINGTRVVSTGETWLQGETHHLSDAEKALLKEGDNVIAAHCHNTTGGALLDYGLYK
NLKTEHSDIQIAKQTSVDVLATNTYYTFECGPVMLDVVFTAPMLMDDLDLLSTPINYVSY
QVRSNDGADHNVQFYLATSPELTVNQTSQPTISRRTTQNGTPYLYTGTVEQPVLKKAGDL
ICIDWGYLYMPGFNGELSLASTLTVEHEFASTGKLPTTQRVVTSHNASDMPALAYMHDFG
TVKEGSSFTMLGYNETYDITYMGRNYKGYWARNGKTIFSAFQEMYDNYADIMARCRRMDQ
QIYDDGLAAGNKKYAELLSASYRQVIAAHKLFEDKDGHLLYFSKENNSNGCVNTVDLTYP
SAPLFLLYNPELQKGMMTSIFEYSYTGRWTKPFAAHDIGTYPIANGQVYGGDMPLEESGN
MITLAAMICRLENSTSYVDKYWDIIKTWTDYLVENGQDPANQLCTDDFAGHWAHNANLSI
KAIMGVAGFAEMARIKGDEATATQYMDKAKEMARIWESTAREGDHYRLAFDRANTWSQKY
NMVWDKLWNIHIFPTGTIERDLQYYLNKQNTYGLPLDSREAYSKSDWILWTASMAQDKET
FLKFSDPVWKYVNETRTRVPICDWYWTNSGDKRGFMARSVIGGHWMKVLMDKYGTVVPPS
KEWAPAGNKMKTRWTAEVNPDNVLPEYPRPLLQRGEWVNLNGLWQYGFNTSSSNTEPSVY
DGEILVPFALESSLSGVMQPMSENNALWYKREFAIPEEWNGRNVRINFGGVDNNARVYVN
GNNVSTHIGGFSAFSADITRYLNAGGTNVITVKVTDATDGTSQPLGKQRKDTQDNGSIWH
SPVSGIWQTVWLEPVAANFISDIKTTPDVDNHRFVVNATTNATAADAVVKVVLKDGSDVV
AEGSGAPGTDIVLSVNSPKLWTPQTPHLYDMEASLTVGGNTVDNVSSYAAMRKISVARDK
DGVWRMQLNNENLFQAGVIDQGYWPDGLYTAPTDEALASDIEAAKNLGYNMIRKHMKVEP
ARWYYHCDRLGMLVWQDMPALSESYEEWNGTDWYTGTDGRPSLSARPNYRNEWTAIINQH
YSNPSIVVWTPFNEAWGQFTTKTIVSTTRNLDDTRLIDAASGGNHHAEVGDMLDLHDMSD
SPSVFLSDDARPVVLGQYGALKYNVEGYRWVPEYAETTYTSGDELTDAYTAMTDKVEALA
AVNEGKAFSAAVYSQLTDVETEHDGLITYDRKLVKVDAAKVRAANDKLTGSLTPTGIDGV
TDNGSRPVEQARYNVSGQRVQHGVKGVNIVRYSDGTTRKTVIK

Enzyme Prediction     

No EC number prediction in MGYG000004703_00824.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	873	1342	1.5e-100	0.5398936170212766

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16335	DUF4965	7.04e-91	489	658	1	174	Domain of unknown function (DUF4965). This family consists of uncharacterized proteins around 840 residues in length and is mainly found in various Bacteroides species. Several proteins in this family are annotated as Glutaminases, but the function of this protein is unknown.
pfam08760	DUF1793	2.09e-69	664	829	1	169	Domain of unknown function (DUF1793). This presumed domain is found at the C-terminus of a glutaminase protein from fungi. This domain is also found as a single domain protein in Bacteroides thetaiotaomicron.
pfam17168	DUF5127	1.37e-68	262	485	1	226	Domain of unknown function (DUF5127).
COG3250	LacZ	1.84e-32	880	1354	15	481	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	1.17e-30	879	1123	14	267	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCA48091.1	3.83e-308	151	832	13	700
AHW60263.1	4.38e-195	842	1428	20	597
QUT49305.1	1.11e-194	21	829	23	659
SNV38566.1	2.32e-193	842	1432	20	600
ADY33215.1	2.32e-193	842	1432	20	600

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	3.54e-176	842	1432	4	586	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
5C70_A	4.25e-24	878	1412	21	585	Thestructure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae],5C70_B The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae]
5T98_A	4.65e-24	928	1295	87	445	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
5C71_A	8.37e-24	878	1412	46	610	Thestructure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_B The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_C The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_D The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae]
4JKM_A	2.89e-23	878	1274	16	415	CrystalStructure of Clostridium perfringens beta-glucuronidase [Clostridium perfringens str. 13],4JKM_B Crystal Structure of Clostridium perfringens beta-glucuronidase [Clostridium perfringens str. 13],6CXS_A Crystal Structure of Clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4-tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl)morpholine [Clostridium perfringens str. 13],6CXS_B Crystal Structure of Clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4-tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl)morpholine [Clostridium perfringens str. 13]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2U4L7	3.40e-68	254	830	97	690	Glutaminase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gtaA PE=1 SV=2
D4AMT2	4.09e-40	273	832	123	786	Probable glutaminase ARB_05535/05536 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05535/05536 PE=1 SV=2
T2KPJ7	3.53e-29	918	1276	96	432	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
T2KM09	3.83e-22	928	1369	109	518	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
Q6LL68	7.76e-19	879	1338	48	533	Beta-galactosidase OS=Photobacterium profundum (strain SS9) OX=298386 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000249	0.999122	0.000167	0.000165	0.000153	0.000137

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004703_00824.