CAZyme Information: MGYG000004703_01330

Basic Information

• Species: Prevotella sp900556275
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900556275
• CAZyme ID: MGYG000004703_01330
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
857	MGYG000004703_42|CGC1	95621.89	6.5065

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004703	2398084	MAG	China	Asia

• Gene Location: Start: 5594; End: 8167 Strand: +

Full Sequence      

MKQQRGHTSCLLSAMIIACVIGCKPHTATDSVTRTAALDAAAWNNSKWISVKNAPVVKGV
NNERAADGANWFVTSFSNDKKVVSATWMTAGLGVYQLYINGRQISREVLKPGFTHPFKTK
RSFTYDVTGAIDRKAGATNTLSVQVTPGWWADKIVTPGGTDGMYGTKCAFRGVLLLTYAD
GSTEYVNTDTDHWRAGIAGPVKHAAIFDGEEYDAREPMGYDCAASMDMAEENREFKGEIV
PSDGAEVYKRPDIALNPVRAYVWQGVRGAKEKEHGKVIITREYQPGDVMTVNPGEELVVD
FGQNSAAVPSFVFKGDEGTTLTCLPAELLNDGNGAQSRGMDGPEGSVHRDNLRIPNAGCR
MSYVFGQSDDYVSYEPSCTFFGYRFVSISANGGPVTIKSLRSIPVTSIARELETGRITTG
NDMVNKLISNTRWGQMSNYLSVPTDCPQRNERLGWTADTQVFTETGTFFANTRKFFHKWM
RDMRDTQHPKGGFPGVAPLAQYGNEYTRLGWSDAGIIVPWTIWKQFDDTQIVEENWQAMD
LLMGHLNDTKYDHKALIDENFNYQWADWLSYEPLESCSGLAFTSDGPKPEAIDYWNYLSA
CYWAMDATMMRDMARATNRNAAKYQRMADEAKAYMREKFLNADGTFKTDILNTMQTPALF
ALKTGLVEGEAKTNMIARLRQNFKDHDMCLQTGFLGTSILMPTLTENGMSDIAYALLYQR
KNPSWLYSIDNGATTIWERWNSYMVDKGMGPRGMNSFNHYAYGCVCQWIWESVAGIAADP
QRPGFKHIIMRPVPDKRLGHVEAEYQSAAGLIKSAWRYEGDKWIWQFTIPEGAIATVTVP
GETTSKEYGSGTHKITK

Enzyme Prediction     

No EC number prediction in MGYG000004703_01330.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	290	838	7.7e-145	0.9920634920634921
CBM67	47	217	2.9e-16	0.8352272727272727

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	3.11e-102	413	773	2	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.97e-30	80	244	1	165	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	5.16e-19	775	854	1	78	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	3.65e-11	290	389	2	85	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU59244.1	0.0	1	857	1	856
QQR15843.1	0.0	1	857	1	856
QRM99526.1	0.0	11	857	11	856
ALJ47829.1	0.0	11	857	11	856
SCV07234.1	0.0	11	857	11	856

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	2.26e-114	36	856	280	1029	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.79e-85	72	854	134	862	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	3.18e-68	69	840	176	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	9.65e-114	36	856	280	1029	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	3.73e-102	73	840	180	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	6.41e-100	74	840	175	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000001	0.000091	0.999955	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004703_01330.