CAZyme Information: MGYG000004703_01584

Basic Information

• Species: Prevotella sp900556275
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900556275
• CAZyme ID: MGYG000004703_01584
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
486	MGYG000004703_57|CGC1	53898.18	4.7267

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004703	2398084	MAG	China	Asia

• Gene Location: Start: 10914; End: 12374 Strand: +

Full Sequence      

MGFTLRKSNPFQKTFNNEKQVFTLFQYNTDAITMTKNYFILLFMFIMAVACSGNDDDNNS
DDNNGELSCVPQQIEAAAAGGDYTINVKCDRGEWTAVVDDNSNSWIGVTVSGSLSKQGTV
TVKVAKNNGTTVRKGNVMVKSGRQWMNIPVIQGLPLQVSATSLQSLSTGETMHVTVISEA
EWNVTANEQWLTTSKKTDGIDITTAPNQAMTSRTGTVDVTCGTEKVTITVIQNSAEDKDI
IAPDGYKLVWNDEFNIGETLGSDWTHEVQSAGWVNNEQQNYVNHKTSSGSLVTELTDGRL
HINCFKENNKIYSGRVYAKVNSGWQYGYMEARIKLPKGKGTWPAFWMMPANNDFGKNPWP
GCGEIDIMEEVGVDAGVVSSTIHCNKYNNGGTRTEHGEKYLATAESDFHVYACEWTPSYL
RFFVDGESILTYRNDGTGVDAWPFDKPFYIILNLAWGGDWGGYKGVDESALPVTMEVDYV
RVFQKK

Enzyme Prediction     

No EC number prediction in MGYG000004703_01584.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	250	483	1.5e-73	0.9956521739130435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	1.12e-86	250	483	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd08024	GH16_CCF	9.39e-38	248	484	1	330	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.
cd02182	GH16_Strep_laminarinase_like	1.40e-37	245	484	1	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
cd00413	Glyco_hydrolase_16	1.41e-34	252	483	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
pfam00722	Glyco_hydro_16	1.92e-26	325	481	32	168	Glycosyl hydrolases family 16.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ61571.1	3.83e-189	34	486	1	452
QUT92859.1	3.96e-189	34	486	1	453
SIP56442.1	1.03e-187	30	486	38	494
QUT60462.1	2.78e-173	21	486	11	478
QQA28932.1	2.71e-172	38	486	3	453

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6XOF_A	3.60e-58	243	486	21	269	ChainA, GH16 family protein [uncultured bacterium]
3ILN_A	5.81e-58	246	484	5	248	ChainA, Laminarinase [Rhodothermus marinus],3ILN_B Chain B, Laminarinase [Rhodothermus marinus]
6XQF_A	1.96e-57	243	486	21	269	ChainA, GH16 family protein [uncultured bacterium],6XQG_A Chain A, GH16 family protein [uncultured bacterium],6XQH_A Chain A, GH16 family protein [uncultured bacterium],6XQL_A Chain A, GH16 family protein [uncultured bacterium],6XQM_A Chain A, GH16 family protein [uncultured bacterium]
5WUT_A	2.08e-51	245	484	4	235	Crystalstructure of laminarinase from Flavobacterium sp. UMI-01 [Flavobacterium sp.],5WUT_B Crystal structure of laminarinase from Flavobacterium sp. UMI-01 [Flavobacterium sp.]
3ATG_A	1.23e-47	248	483	5	238	endo-1,3-beta-glucanasefrom Cellulosimicrobium cellulans [Cellulosimicrobium cellulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45798	3.24e-57	246	484	40	283	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1
P23903	2.83e-37	245	486	422	682	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
C1IE32	3.21e-36	248	481	22	265	Glucan endo-1,3-beta-glucosidase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
Q9ZG90	5.55e-35	241	484	51	288	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1
Q27082	5.45e-34	246	484	25	253	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.349070	0.441286	0.208917	0.000256	0.000245	0.000217

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004703_01584.