CAZyme Information: MGYG000004704_00477

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Sutterella
• CAZyme ID: MGYG000004704_00477
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
327		35936.76	6.6926

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004704	1821922	MAG	China	Asia

• Gene Location: Start: 13728; End: 14711 Strand: -

Full Sequence      

MRGYVEVIKPLPRLYSLRNEIVERFISSQPRVFVGVDAPDFNLGVEVRMRRAGIPVVHLV
SPSIWAWRPERIQSIRRSVDHMLTVFPFEKAIYDKAGIDCTFVGHPLASIIPDEPDTMGA
RKELGLPDDGMRVLCVMPGSRASELKGCAGVFFNAVERLIERTGPVRVVVPTVDEAAAQG
LRSTLEQFPNLKMHLHIEPGRSHKAIEASDAVLVASGTATLECALFKKPMVVGYKMPSVT
GLVMEKQGLIPYVSLPNILLGRRVVPEFLQFFCEPDPISYAVGDALEDGAHREELARVFS
GLHESLKADTAAITADVVASVARAPEF

Enzyme Prediction     

No EC number prediction in MGYG000004704_00477.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	2	306	3.1e-98	0.8389830508474576

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.22e-138	3	323	59	376	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.53e-116	3	318	59	375	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	8.76e-84	3	293	56	346	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	5.62e-82	3	319	63	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	2.37e-30	3	270	52	301	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDA54177.1	8.86e-142	1	318	68	385
BBF22932.1	2.16e-135	1	322	68	388
QQS88891.1	1.16e-134	1	320	67	386
ANU65980.1	1.87e-106	1	321	62	380
QQQ97139.1	1.87e-106	1	321	62	380

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.36e-70	13	323	74	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	3.81e-70	13	323	74	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2JIB3	5.72e-105	1	324	64	384	Lipid-A-disaccharide synthase OS=Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815) OX=391038 GN=lpxB PE=3 SV=1
B2T5I1	1.06e-102	1	321	64	381	Lipid-A-disaccharide synthase OS=Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN) OX=398527 GN=lpxB PE=3 SV=1
Q13XC9	4.24e-102	1	321	64	381	Lipid-A-disaccharide synthase OS=Paraburkholderia xenovorans (strain LB400) OX=266265 GN=lpxB PE=3 SV=1
A1V555	5.82e-102	1	321	64	381	Lipid-A-disaccharide synthase OS=Burkholderia mallei (strain SAVP1) OX=320388 GN=lpxB PE=3 SV=1
Q62JD7	5.82e-102	1	321	64	381	Lipid-A-disaccharide synthase OS=Burkholderia mallei (strain ATCC 23344) OX=243160 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000085	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004704_00477.