CAZyme Information: MGYG000004704_01387

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Sutterella
• CAZyme ID: MGYG000004704_01387
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
196		21611.77	10.2291

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004704	1821922	MAG	China	Asia

• Gene Location: Start: 93; End: 683 Strand: +

Full Sequence      

MINTSVSARGHGTLWNQRFPTPYRSAVKTAAADSNLPEAWIYGIMRQESRFMETVGSGAG
ARGLMQIMPRTGRWLARKSGMKGFTTEDLGDPAVNIPLGSMYLGLLDEAFEGEKVLATAG
YNAGPSRARKWQNRLSKPMEGAVFVESIPFYETRDYVKNVFLNTAVYAQRLGDKTLTFRS
LLGTIIPGADKNIQLP

Enzyme Prediction     

No EC number prediction in MGYG000004704_01387.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	39	165	7.5e-24	0.7777777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13401	Slt70-like	3.88e-75	18	170	1	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	3.46e-49	20	163	1	143	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	2.95e-39	18	175	134	291	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
PRK11619	PRK11619	3.04e-38	5	175	458	632	lytic murein transglycosylase; Provisional
cd00254	LT-like	9.56e-35	38	160	1	106	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWL05164.1	1.85e-53	1	187	468	653
QYG00596.1	6.84e-53	1	187	467	652
BBF22242.1	2.49e-52	1	196	599	794
QQS89613.1	2.52e-51	1	196	608	803
AMP07298.1	4.79e-51	1	196	464	658

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	2.21e-37	18	185	411	573	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	2.28e-37	18	185	415	577	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	2.39e-37	18	185	421	583	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	2.46e-37	18	185	425	587	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	2.57e-37	18	185	431	593	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC3	2.03e-30	5	174	459	632	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	2.03e-30	5	174	459	632	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P39434	5.87e-26	5	174	459	632	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P44888	9.33e-23	2	160	408	565	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
O31976	7.16e-14	1	180	1400	1554	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004704_01387.