CAZyme Information: MGYG000004705_00631

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485
• CAZyme ID: MGYG000004705_00631
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
332		37405.51	7.9639

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004705	2427413	MAG	China	Asia

• Gene Location: Start: 26371; End: 27369 Strand: +

Full Sequence      

MSFHVASAGIMRTSNLIKYLYICIMNRGKIFGRYDSGALAYLMLSLLILCYTPASWGKTD
RYKEYIERYSAMAESEMAEFGIPASITLAQGLLESAAGASTLAREGNNHFGIKCHNSWNG
ATMLRNDDAPDECFRVYDDAANSFRDHSLFLTRKRYASLFLLDPTDYSAWAHGLKKCGYA
TDPHYADRLIAIVERYELYRFDTPGNKRLEADVEFIKGVLGKSRRVCRYRGLHYIVASPG
DTYSSLAKEMNIDASKLATYNDSDDPDAEIKAWEEVYLQPKLTTSPDDTRTATIGQDETI
HSVAQRFAMTVKTIIALNPKAKDRPGTRLKLR

Enzyme Prediction     

No EC number prediction in MGYG000004705_00631.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	73	198	3.1e-34	0.9609375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF038016	sporang_Gsm	2.96e-36	32	202	132	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
COG1705	FlgJ	1.98e-33	32	215	2	201	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
pfam01832	Glucosaminidase	7.99e-25	71	198	2	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
smart00047	LYZ2	4.87e-21	62	202	8	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
TIGR02541	flagell_FlgJ	9.85e-21	57	193	143	290	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBW22044.1	1.23e-71	58	332	26	299
AKA51347.1	1.23e-71	58	332	26	299
ALB75916.1	1.23e-71	58	332	26	299
CAH07137.1	1.23e-71	58	332	26	299
QUU02268.1	1.23e-71	58	332	26	299

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DN5_A	2.67e-11	63	195	4	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	3.54e-11	63	195	4	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	9.89e-09	65	193	4	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	1.15e-08	65	193	5	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	7.26e-08	65	193	5	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	2.95e-13	60	202	46	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	4.72e-11	51	197	152	306	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
P58231	3.92e-10	33	195	123	293	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1
P75942	3.92e-10	33	195	123	293	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1
P15931	9.70e-10	63	195	153	296	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.979827	0.019742	0.000259	0.000033	0.000023	0.000108

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004705_00631.