CAZyme Information: MGYG000004705_01281

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485
• CAZyme ID: MGYG000004705_01281
• CAZy Family: GT9
• CAZyme Description: Outer membrane protein assembly factor BamD

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1240		135528.39	6.6917

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004705	2427413	MAG	China	Asia

• Gene Location: Start: 15834; End: 19556 Strand: +

Full Sequence      

MILVTRFSALGDIAMTIPALYDACRSNPERQFLMLTRKGPAKMFVNRPDNLRVAGIDLDE
YKGAAGLWRLASRLADAGVTMMVDLHDVLRTKALRGFLATRGIRSTHIDKGRREKKNLTR
ANHKHIVPLKNSIERYRDTFTRAGLRMEKSFSTIFPDGADPALFAAATAPKKEGERWIGL
APFARHKGKIYPPELMEQAIADMTSKQGVKIFLFAGGPEEEARAALWAAKYPGIVNLAPL
HMGFEAEMALMSHCDAVISMDSANMHLASLAGTRVISIWGATHPYCGFMGFNQNEKDTLQ
LEMSCRPCSVFGDKPCRRGDYHCLNGITPQRIVKAVGLSVAAALLLPLSAIGRPGEPTVF
NPTFPVHTGMPGPQTTEVPSPESPEINIYLTAEAADALATGKFQDAYSIYLRVVPTRLPL
SMRAGYWYGVASATARLGLLDETARAATALRSEDGATGAVHFLDGYLAYRKGHMAEARRY
LSNTPPEYVPGIYLSQIDFSEGKWADAARRATESMAIIEKERSGVNAQLLPELTRTAALS
YFKMGERHKARTMLEKYMDMCGESPSDDARYALGQIEYEDGNNETARKLLSPLTATDGQF
AQGASYTLAQMEARDGHDREAALGFSRAARLNFDPNIGQNAIYNYIAAGTNGATVPFASA
ADMYESYLANGRATGHDDQLALRFAREYYHEGNYAKALECVELIAVPDAEAISDKQKILY
QLGRMEVAARKYSDAIRHLAAGATLRGGDSRLAAECRLWLGDARYAEGNYTKAAEAYSSA
IKGLSGANRTLALYNYAYSLFSQDKFSQAAKAFADAIAARAALPVSQRDDAKLRLADCRF
YTGNYAEALKGYEEGTHSGSGADYAAMRQAVALGLTGDLERKIRILSSFASSYPGSRWIP
DAMLELGNTYAALDRQDEAASAFARITASHPASPQARKATLAMAQSLVKKGDTTGAMEAY
RNVIRSWPSSEEAMIANDDMMRLSASEGSIREYAEFLKTVKGAPSIDSEKMEALAFEAAE
NAWADDITDIRRLREYLTEYPDGRFVAQALLDIAESELQSDNRAEALSAYMRLEQKGGAD
YAPEAYVGVMRTTDDPHQRGEYASKVLATGGVEPEAMEEARLFNAIGMLSSPSSRTEAVS
LLTEMASHPDIESGARAAVELGEWQLKQGQLGEALKTLTAFTDAGSPHSYWLARGFIALS
DTYRKKGQTTLADEYLRSLKANYPGSEPDIINAISSRLKK

Enzyme Prediction     

No EC number prediction in MGYG000004705_01281.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	68	318	2.5e-32	0.96

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	7.86e-38	2	336	2	275	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	5.75e-32	2	336	4	326	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	8.19e-16	68	322	2	247	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
TIGR02795	tol_pal_ybgF	4.89e-13	888	980	25	117	tol-pal system protein YbgF. Members of this protein family are the product of one of seven genes regularly clustered in operons to encode the proteins of the tol-pal system, which is critical for maintaining the integrity of the bacterial outer membrane. The gene for this periplasmic protein has been designated orf2 and ybgF. All members of the seed alignment were from unique tol-pal gene regions from completed bacterial genomes. The architecture of this protein is a signal sequence, a low-complexity region usually rich in Asn and Gln, a well-conserved region with tandem repeats that resemble the tetratricopeptide (TPR) repeat, involved in protein-protein interaction.
COG1729	YbgF	4.02e-11	868	976	146	254	Periplasmic TolA-binding protein (function unknown) [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQR08225.1	4.26e-119	2	336	12	348
ANU64408.1	4.26e-119	2	336	12	348
ASB37493.1	4.26e-119	2	336	12	348
QCD37124.1	2.25e-118	2	336	5	342
AHF12543.1	1.86e-101	2	343	6	350

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2GT1_A	1.45e-07	2	293	3	294	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
6DFE_A	1.45e-07	2	293	3	294	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
2H1F_A	1.51e-07	2	293	3	294	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24173	7.60e-07	2	293	3	294	Lipopolysaccharide heptosyltransferase 1 OS=Escherichia coli (strain K12) OX=83333 GN=rfaC PE=1 SV=1
P26469	5.53e-06	2	312	3	314	Lipopolysaccharide heptosyltransferase 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999277	0.000746	0.000014	0.000001	0.000001	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004705_01281.