CAZyme Information: MGYG000004705_01805

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485
• CAZyme ID: MGYG000004705_01805
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376		42253.16	9.9084

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004705	2427413	MAG	China	Asia

• Gene Location: Start: 4395; End: 5525 Strand: -

Full Sequence      

MKYMLVAGEASGDLHASALIEQIKLRDPEAKFIFFGGDLMAKAAGHEPALHYSRMNVMGF
TEVVKNLPSILDNFRFASSILAKFNPDVLILVDYPSFNLQLARKAHAAGIRVDWYIAPKV
WAWKEWRVAKIRKYVTNLYCILPFEVSFFRNHGYGKAKYVGNPSVDEIDDRLRHLPPEKY
FRERQGITDPRPIIALLPGSRLSEIKANLPLMIEAAKKEKDYQYVVAAAPSVGEKFYREV
AQDPGLQLVFSATVPLLKYSRAALVTSGTATLETALVGTPQVVCYRGNGSGLTYDLMSRL
LHVRYVSLPNLIVGNSIVPELLLNRCTAESISRELRPLLIPSPRREWEMSGYRLMRRRLG
TANAATRAAELITDPK

Enzyme Prediction     

No EC number prediction in MGYG000004705_01805.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	357	3.9e-108	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.42e-110	1	374	2	373	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.92e-108	1	374	2	377	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.85e-79	5	372	3	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.10e-70	5	370	10	380	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.27e-53	1	331	2	309	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36425.1	2.91e-126	1	374	1	372
QQR08529.1	3.25e-124	1	372	1	370
ASB37800.1	3.25e-124	1	372	1	370
ANU64105.1	3.25e-124	1	372	1	370
BCI64292.1	4.98e-116	1	374	1	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	4.55e-40	5	339	11	345	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	8.83e-40	5	339	11	345	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	7.77e-78	2	374	6	376	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
C1F718	1.80e-63	5	365	9	377	Lipid-A-disaccharide synthase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) OX=240015 GN=lpxB PE=3 SV=1
Q39T49	1.81e-62	2	374	8	378	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q2LVL8	4.92e-62	4	369	7	371	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
B3E4H8	8.23e-60	2	372	8	376	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004705_01805.