CAZyme Information: MGYG000004705_01873

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485
• CAZyme ID: MGYG000004705_01873
• CAZy Family: GT90
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
322	MGYG000004705_24|CGC1	38270.46	10.0006

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004705	2427413	MAG	China	Asia

• Gene Location: Start: 8920; End: 9888 Strand: +

Full Sequence      

MKLVAKIRFIFNSGKNPKWKYYLLSAIREAWPKILLRSRLSQRLAEAERRPDYEYIKRRR
DYYCRLSGKRGAGSEAICLSELKVKKPKVYYHDTMRYTRWFNPDLKLQLLAGDIVHVPET
PCVVKSRPLVADVACSTLLKLDRVRHFIFVKDKLRWEEKKSMVLFRGKVGGKESRREFMY
RWFGNPLVNSGDVGRNPERPEWHSRKLTIYEQLRYKFIMAIEGNDVASNLKWIMSSNSLA
VMPEPTCETWFMEGMLKPDFHYVRVKPDFSDLEEKVDYYLTHPDEAEAIIRNAHAWVDQF
RDEKREDLISLMVLRKYLDSVN

Enzyme Prediction     

No EC number prediction in MGYG000004705_01873.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	151	303	3.1e-17	0.688

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00672	CAP10	1.45e-11	153	293	77	225	Putative lipopolysaccharide-modifying enzyme.
pfam05686	Glyco_transf_90	3.38e-10	151	308	150	303	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.
pfam13524	Glyco_trans_1_2	2.62e-06	252	297	34	78	Glycosyl transferases group 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYS92068.1	5.26e-115	7	322	3	319
QSG83178.1	2.45e-113	7	322	3	319
AUX18339.1	3.47e-113	7	322	3	319
QQT24222.1	1.96e-97	4	322	1	318
QQT34018.1	2.07e-94	4	322	1	318

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39907	8.67e-60	18	317	11	311	O-glucosyltransferase LpsA OS=Dichelobacter nodosus OX=870 GN=lpsA PE=3 SV=1
Q566E5	4.77e-07	156	319	305	471	Protein O-glucosyltransferase 3 OS=Rattus norvegicus OX=10116 GN=Poglut3 PE=2 SV=1
Q7Z4H8	1.50e-06	156	319	304	470	Protein O-glucosyltransferase 3 OS=Homo sapiens OX=9606 GN=POGLUT3 PE=1 SV=2
G5E897	3.52e-06	156	319	300	466	Protein O-glucosyltransferase 3 OS=Mus musculus OX=10090 GN=Poglut3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004705_01873.