CAZyme Information: MGYG000004706_00483

Basic Information

• Species: Olsenella_B sp900768455
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; Olsenella_B; Olsenella_B sp900768455
• CAZyme ID: MGYG000004706_00483
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
811	MGYG000004706_1|CGC4	92422.71	5.1413

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004706	2415363	MAG	China	Asia

• Gene Location: Start: 534801; End: 537236 Strand: +

Full Sequence      

MNITTKGICRHAEKIYQLISREGVSQNALLDIQAQDDNGWDVPAKVFRDTPTEAVVVLVD
VHSSTSSISYTIFASDGAIQEASAWFEVGEATVSLRDAKLQSRMNYRVHKDLTNRIRDYD
YGHQFLFSTIFIKKAIPDRGAAIVRIAIRVPWREDGEVALRVRDQALAPVDSAPIFMGSH
KFDARFSPMIKFRETVFSVRLPRDERTVIFDARDKADPHQHTFFELAKPDLDHLIYENEE
LTRSADRDPYYNEWLHKQQVQPWELRLQSEVRFDNEVTWSVVVPLFHTTPQQFKDLVASF
RAQSYPLWELVLVDASPEDGELAEEVAAAVASDERIRSITLHKNMGITLNTAAGIRAATG
DFVGFVGHDDTIEPDLFFHYTEAVNKEPETDVLYCDEDKIDPKGTHVQPFLKPQLEIDLL
TCKNYISHMLAVRRSLLMSLEFDNPAFEGAQDHHLTLQAVEKARRVTHVPRVLYHWHMWE
TSTAASGDAKGYAQEAGMAAVRAHFDRIGVDAEVSEGERPFSYHVFHKPPATHPLVSILI
PSRDHVDLLQRCIDSILGKTTYDNYEVVVIENNSELEETFSYYQHVQHENKERVRVVTWE
GKGDFNYSSLINFGAKESSGDYLLLLNNDMELRTPDWLERMVGLASRKNVGAVGARLLFP
DNTIQHAGVIVSGGCANHFGTDLPDSDHGYWSLIECEQDLSAVTGACLMTRRELFEEMNG
LDETFAVTFNDVDFCLRLRSRGLLVVYTPQVSLTHFESVSRGSDYSPEQHDRFEHEIGLM
REKWPSYYAEGDPAYSPHLRTYGPLNSYWHF

Enzyme Prediction     

No EC number prediction in MGYG000004706_00483.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	537	665	2.7e-19	0.7294117647058823
GT2	280	435	6.1e-17	0.9588235294117647

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	7.94e-64	280	476	4	200	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	1.84e-39	538	757	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	2.28e-27	534	763	3	227	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	1.65e-17	537	715	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	2.71e-16	538	659	1	117	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZH69456.1	4.25e-233	1	810	16	822
ATP53720.1	9.65e-232	1	810	16	822
ACV56016.1	6.78e-230	49	810	38	793
QOY61387.1	2.52e-228	1	809	1	807
ACV56006.1	2.40e-185	40	799	77	820

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	5.31e-112	272	799	361	888	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.01e-91	268	799	310	831	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P71059	7.06e-08	280	474	6	209	Uncharacterized glycosyltransferase EpsJ OS=Bacillus subtilis (strain 168) OX=224308 GN=epsJ PE=2 SV=1
P9WMY2	1.33e-07	621	764	93	244	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P9WMY3	1.33e-07	621	764	93	244	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004706_00483.