CAZyme Information: MGYG000004706_01659

Basic Information

• Species: Olsenella_B sp900768455
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; Olsenella_B; Olsenella_B sp900768455
• CAZyme ID: MGYG000004706_01659
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1010	MGYG000004706_5|CGC1	108988.98	4.3787

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004706	2415363	MAG	China	Asia

• Gene Location: Start: 71656; End: 74688 Strand: +

Full Sequence      

MRETTMTRRQLFGTAGSVAAGAVAATALSGCSGTGVEMTRTTPQIPDPDQAKEAAYKVAA
RIQDEGTVLLKNSGVLPLVKGSVVMPFGRAYLDPIYGQLTSGGSAKWSVDPVTPEQGLSA
FSIDGSAVDAMRAAGDPEALEEAEGTSAAGKAGSMLGGDCRIYEYDPSIYDGIAESPEAT
GIVFVTRSGQEGQDQKMDAYSDGTPHYLALSKSERGAIAAAKRICGAVVVVIVGSAPMEV
GDLTSGSLEVDAIIHYGHPSERGFSELSALLDGDVNPSGRTVDTWSRDFTADPSYVSVGL
HTYDNLPITSGSLTDGGEFMRTFNEYQEGVYMGYRYYETAALVDPSFSYDDAVVFPFGFG
LSYTSFTQSLDSVVDDGVDVTARVTVTNAGDVSGKDVVQLYAASPYTEMDQAEGIEKPAC
QLVDFAKTDLLAPGQSQTLELSFDREDMASYCYTRENPNGTVGCYVLEAGDYEVSLRENS
HAVIARGTVTQDETLWFDGSDAEHTRRSERDAQSALDDQGNPVEDAGQAYVAASNRFQAS
SDYMRAQSRILSRADWAGTKPVYEATKSIDDEFAEGHDLFVTFDPATDARLGNVEGSLVY
AADEPTSGAKNGLVASDLRGAAYDDPRWDALLDQIDWDADKSGIVRNFSGDAYVTAAIDS
IGLPATIDMDGANGLKVQGSDNGYDMTKSCSYGYEPLAAATWSKDLLYQMGEAIGTEGLA
HGISGWYSPGLNLHRSFFSGRVFEYYSEDPVLTGKLAERVVSGAGDQGMYCYLKHFALNE
TDTGRAQLICTWADEQTMRELYFRPFEIALKEARKTVRYTSDDSGAVAEKVMRAGTAVMA
SQTCVGTIIGHCNYALLHDILREEWGFEGMVISDYWVWNGNNHRDLAMRAGCDTYLCMSV
PAMWSISDYDSPTARACMRRAIHNLAYTVTNSSAMQGMVPGAVQKTAESPWWGIIRGVDV
VAAALVAGGVALIARRTKAEREHPELYRRSKRKQAKLDRKRAEKDAGEKD

Enzyme Prediction     

No EC number prediction in MGYG000004706_01659.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	657	895	2.3e-44	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	3.79e-27	699	893	90	275	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK15098	PRK15098	8.48e-22	52	483	384	757	beta-glucosidase BglX.
pfam00933	Glyco_hydro_3	1.71e-21	699	896	95	283	Glycosyl hydrolase family 3 N terminal domain.
pfam14310	Fn3-like	1.30e-14	396	476	1	67	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.
pfam01915	Glyco_hydro_3_C	1.85e-12	67	334	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAQ32630.1	1.72e-279	50	991	79	1031
QYN59798.1	6.20e-244	51	981	79	1025
QTL79308.1	8.95e-229	49	993	75	1064
QOL34092.1	1.49e-226	33	988	48	1037
ADK68812.1	6.83e-179	49	951	74	937

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WUG_A	1.16e-48	65	876	46	749	Expression,characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii],5WVP_A Expression, characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
2X40_A	4.66e-33	649	893	37	258	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	2.54e-32	649	893	37	258	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
7MS2_A	6.94e-28	640	908	16	258	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.58e-27	650	891	24	246	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15885	4.48e-56	59	876	13	698	Beta-glucosidase OS=Ruminococcus albus OX=1264 PE=3 SV=1
P16084	7.15e-48	42	892	10	790	Beta-glucosidase A OS=Butyrivibrio fibrisolvens OX=831 GN=bglA PE=3 SV=1
P27034	4.33e-30	651	904	22	245	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
Q5BFG8	3.59e-27	662	904	42	255	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
P14002	3.80e-27	640	908	16	258	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as TATLIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	0.000007	0.000105	0.999895	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004706_01659.