CAZyme Information: MGYG000004707_00214

Basic Information

• Species: Monoglobus sp900554105
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales; Monoglobaceae; Monoglobus; Monoglobus sp900554105
• CAZyme ID: MGYG000004707_00214
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366	MGYG000004707_3|CGC2	42053.65	5.0525

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004707	1967109	MAG	Denmark	Europe

• Gene Location: Start: 71959; End: 73059 Strand: -

Full Sequence      

MDKQKLLDTAIKMADTLMNDRLPIISEKWQYDCGLALLGIGAVYKTTGDEKYFDYIKKSM
DYFINDDGSINKYDQSLYNIDHINNGKNCFWLYNETGEEKYIKAVEILKKQLSGQPRTKS
GAYFHKLIYPNQIWLDGLYMGEPFSAQYAKECGHPENFDDVVNQFVIAERSTYEPRCGLY
AHACDESREAFWADKTTGRSKNVWGRACGWFCMAILDSLDFIPESHLGHKILIDIFNKAI
SNIVKYQDESGVWYQVLDNRRSDNYKEATCSCMFAYSLNKAIRLGYIDEKKYKPYLEKAV
DGIFNEFIRTDGDKVYLTNCCAVAGLGPESNPVRDGSLDYYFNEIIIENDTKGVGPFLIL
AANYIY

Enzyme Prediction     

No EC number prediction in MGYG000004707_00214.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	27	364	1.6e-112	0.9608433734939759

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.08e-104	29	364	34	353	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	8.20e-97	28	365	26	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUO20415.1	7.51e-229	1	366	1	366
ADL43392.1	1.44e-121	10	362	13	367
ADQ41452.1	4.10e-121	10	362	13	367
AEM72744.1	7.08e-121	13	362	1	352
AEM73046.1	8.24e-121	10	362	13	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	8.08e-109	13	364	8	358	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.25e-67	7	359	14	359	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	5.27e-67	7	359	4	349	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	4.65e-20	29	303	65	328	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	2.17e-19	29	303	66	329	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	6.85e-67	7	359	14	359	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	2.00e-41	140	362	1	226	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	2.00e-41	140	362	1	226	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	3.92e-24	29	312	29	294	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004707_00214.