CAZyme Information: MGYG000004707_00900

Basic Information

• Species: Monoglobus sp900554105
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales; Monoglobaceae; Monoglobus; Monoglobus sp900554105
• CAZyme ID: MGYG000004707_00900
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
296	MGYG000004707_21|CGC1	32991.66	4.6384

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004707	1967109	MAG	Denmark	Europe

• Gene Location: Start: 21233; End: 22123 Strand: +

Full Sequence      

MKIYVRRDCKTVNEAVSEANAGDTIIIPSGVYKEKINICKKNISLIGDGFVTVTYDAAAG
NTDSRGIEYNTFTSATVTVDKSAEGFKAENITFENSYNRIDSGRKVTQALAMSCAADGAV
FDHCNFLGWQDTLYLCGESHQYVNDCYIEGSVDFIFGDATVLFEDCDINCVREKSYITAA
STADTSEAGFVFYHCYISACDNCGNIYLGRPWRAHTDGVNSHTAFIECTYNFDCAAEGWL
PWHLEPGTEADNTRYLEYKNIDEHGHLIDVSKRVPWSRQLTHDEAEKLMSFVASKK

Enzyme Prediction     

EC	3.1.1.11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	7	289	5.1e-75	0.9409722222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02773	PLN02773	6.74e-55	8	290	16	292	pectinesterase
pfam01095	Pectinesterase	8.44e-55	8	287	11	288	Pectinesterase.
PLN02665	PLN02665	6.42e-49	3	290	70	350	pectinesterase family protein
PLN02682	PLN02682	1.21e-44	25	290	102	357	pectinesterase family protein
PLN02708	PLN02708	1.63e-44	10	280	254	529	Probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUO19045.1	4.57e-171	1	292	1	293
ACU03375.1	2.56e-54	8	286	38	307
AKD03737.1	8.84e-54	25	287	55	299
QQT26960.1	5.34e-53	10	288	36	304
QQT36707.1	1.49e-52	10	288	36	304

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	1.65e-33	8	276	18	281	Pectinmethylesterase from Carrot [Daucus carota]
2NSP_A	5.25e-27	10	285	19	325	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
1XG2_A	6.69e-27	8	295	14	296	ChainA, Pectinesterase 1 [Solanum lycopersicum]
3UW0_A	1.35e-25	11	216	46	273	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
5C1E_A	3.49e-25	14	245	27	258	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	6.74e-43	8	285	16	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
O49298	3.92e-35	25	276	283	516	Probable pectinesterase/pectinesterase inhibitor 6 OS=Arabidopsis thaliana OX=3702 GN=PME6 PE=2 SV=1
Q8L7Q7	2.79e-34	7	292	297	592	Probable pectinesterase/pectinesterase inhibitor 64 OS=Arabidopsis thaliana OX=3702 GN=PME64 PE=2 SV=2
Q9LXD9	6.80e-34	10	280	252	527	Probable pectinesterase/pectinesterase inhibitor 51 OS=Arabidopsis thaliana OX=3702 GN=PME51 PE=2 SV=1
Q9FM79	7.39e-34	25	289	112	367	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000007	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004707_00900.