CAZyme Information: MGYG000004708_00493

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000004708_00493
• CAZy Family: GT4
• CAZyme Description: O-antigen biosynthesis glycosyltransferase WbnH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365		41598.88	8.2892

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004708	1820911	MAG	China	Asia

• Gene Location: Start: 11661; End: 12758 Strand: +

Full Sequence      

MKRIFHIISHFDVGGAERVAVNIAKSETEGCEYHIVELIRGRSKFTPVFINELEAAGIRY
HRGIVPDIRFHYLFERLAAYTFPLWFIFLFIKYRPDVIHSHTEMPDLATYTFFKFFPRLL
RRCRLVRTIHNTRLWTGMKSTGRRVEPFFITHNANVAISKSVQDNYAESYGFLPPIIYNG
VAQTPQRPFENIVKGKTNILFAGRMEPQKGIKVLVEIIEKMSSDRRFHFHVIGDGSLRPF
VEQHLSAQTNVTLLPPIHGLSAYLSSFDYLLMPSEFEGLSIMSLEASMEGLPVIGSGCPG
LGDTLPDGWALNVPGNAADDYVRLLQDVIPTADKAHLAHQARSFAIEHFGVRRMQTAYEN
FYSES

Enzyme Prediction     

No EC number prediction in MGYG000004708_00493.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	192	328	7.1e-20	0.89375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03807	GT4_WbnK-like	1.23e-38	3	362	1	361	Shigella dysenteriae WbnK and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. WbnK in Shigella dysenteriae has been shown to be involved in the type 7 O-antigen biosynthesis.
cd03801	GT4_PimA-like	1.26e-36	3	362	1	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03811	GT4_GT28_WabH-like	1.24e-28	3	349	1	349	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
COG0438	RfaB	1.42e-27	1	364	2	376	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03819	GT4_WavL-like	8.58e-26	4	358	1	345	Vibrio cholerae WavL and similar sequences. This family is most closely related to the GT4 family of glycosyltransferases. WavL in Vibrio cholerae has been shown to be involved in the biosynthesis of the lipopolysaccharide core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH14967.1	4.86e-154	2	362	4	364
QUT35907.1	1.85e-112	3	362	2	354
QQA28752.1	1.85e-112	3	362	2	354
QUT46532.1	8.17e-109	3	364	2	357
QCQ55758.1	9.63e-104	1	362	1	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2BFW_A	6.40e-06	200	326	40	179	Structureof the C domain of glycogen synthase from Pyrococcus abyssi [Pyrococcus abyssi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q48453	3.26e-12	73	308	48	301	Uncharacterized 41.2 kDa protein in cps region OS=Klebsiella pneumoniae OX=573 PE=4 SV=1
P39857	3.56e-09	1	296	1	289	Capsular polysaccharide biosynthesis glycosyltransferase CapH OS=Staphylococcus aureus OX=1280 GN=capH PE=3 SV=1
Q59002	7.15e-08	96	301	91	318	Uncharacterized glycosyltransferase MJ1607 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1607 PE=3 SV=1
A0JZ09	3.21e-07	94	357	107	395	D-inositol 3-phosphate glycosyltransferase OS=Arthrobacter sp. (strain FB24) OX=290399 GN=mshA PE=3 SV=1
P9WMY8	1.75e-06	92	308	105	334	Glycogen synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3116 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004708_00493.