CAZyme Information: MGYG000004709_01283

Basic Information

• Species: QAMX01 sp003149835
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; QAMX01; QAMX01; QAMX01 sp003149835
• CAZyme ID: MGYG000004709_01283
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
745	MGYG000004709_201|CGC1	82956.48	5.4952

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004709	2240013	MAG	China	Asia

• Gene Location: Start: 1857; End: 4094 Strand: +

Full Sequence      

MEHPFEAAAWIGARAGEDAANYPWDAARPEEKPFEPIARSSSLLLRKSFRLDRPVERAEL
SVCGLGLYRFFLNGRPVGDAALAPLRTAFDRRALYDVYDVTGLLRFGENAAACELGNGWF
AANPRFCDWRMKWYCNPRLLARLAIRFADGGAMEVCSDGEWRQSDGAVTANCIYNGFAED
GRLRKKGWDDAGYDDSGWAAAAEVAAPCERIEPNPGPPIRVIRTLRPVRFLRKDSRTLFY
DFGENTGGRLRVCVSGRRGATVTLRHAENAGETGALDTRTNRRAENTDTYTLAGEGVEWF
EPYFTYHGYQFAEITLSEPDVEVLSVEHLVLHSDVGERGGFTSSSPALNALHAAILRTQR
SALMGLPLDCPQRDERLGWLGDAHVTAEVCLCNFDMEAFYRKWLGDIRASQRENGLIPII
APWPHEETSADWSSGYSLIVWYLYKFTGDRSWIAEHYEPLKRYAAFLCRASDGYLLPKSR
FGDWKSALPDFVRGDPECCNTLYLYVNLANLVRFARALGNAADAAAYQKQCEEMRAVLLE
RYYADGRFGADTQFSLAFALTAGLIPAGDRARVLDRLCGDIRAHGTHLTTGILGTKYVMD
ALSENGREPLAYELIMQEGYPSWRDLLDGKNTLCEAWDRSGSGNHCMFGSVDTLFYRMLA
GISIDRSGERDRELVIAPYLPETLPSVSAHVGGTSVVWMQDGDTAQIFIRSAEPYRFVVP
RGFEGAGTAADRPAGTETVCLRRAG

Enzyme Prediction     

No EC number prediction in MGYG000004709_01283.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	233	691	3.8e-128	0.9246031746031746
CBM67	33	207	3.2e-33	0.9090909090909091

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.77e-89	339	657	4	338	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	6.22e-51	54	223	2	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.65e-26	233	332	4	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGY47007.1	4.79e-154	42	703	180	851
AIY87265.1	5.61e-131	46	668	151	784
BBD73297.1	1.93e-130	40	670	124	756
ACI19983.1	2.35e-130	44	668	155	820
ABQ47687.1	3.26e-129	42	724	137	844

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.48e-131	44	668	178	843	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	2.80e-104	2	678	270	947	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	2.49e-94	31	702	120	820	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	1.23e-103	2	678	270	947	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	2.10e-83	8	703	148	860	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KNB2	5.38e-80	45	689	177	842	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
T2KPL4	5.33e-79	31	691	174	872	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999906	0.000099	0.000017	0.000000	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004709_01283.