CAZyme Information: MGYG000004709_01438

Basic Information

• Species: QAMX01 sp003149835
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; QAMX01; QAMX01; QAMX01 sp003149835
• CAZyme ID: MGYG000004709_01438
• CAZy Family: GH127
• CAZyme Description: Non-reducing end beta-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
607		69411.63	5.1583

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004709	2240013	MAG	China	Asia

• Gene Location: Start: 45; End: 1868 Strand: -

Full Sequence      

MIEKIPFDRVEISGGFWKKRQELVRRVTIRAVYDRFCDTGRFEAFRFLWREGEKNRPHIF
WDSDVAKWIESAAYLIQKGSEPELERIVDGLVEEIETHQWPDGYFNIYFTVCEPQSRFQR
RTDHELYCAGHLIEAAVAYCQATGKDRFLRCMCRYADLIERVFMKERSAAFVTPGHEEIE
LALVRLYEATGEARYLALSKFFIDMRGCCEEDEYEFARHSYSQSHLPVREQKTAEGHAVR
AGYLYSGMADIARMCGDAELKDACEAIFRNITERRMYITGATGSSAVGEAFTIDYDLPNL
TAYAESCASIALAFFSERMQRLENDARYADVIERILYNGLLSSISLDGKSFFYENPLEIN
PRLIGRDSSIRRGGSRYPITQRLEVFDCSCCPPNITRFIASLGGLLYTEDEERICCHQFM
ESTASFEHNGKPVRIVQETDYPRSGAVRIRYFGERTQLAVRIPPWCRPAYSGALDRGYAV
FEVVDGSEISLSFDMRPRIVEAHPMVSENAGRVAVMRGPVVYCMEGVDNGANLHAVRLAA
EPGFAEEYDEAFGTVLYAGAFRMAAADENALYGETPARREAFTARLIPYHTFANRGETEM
LVWMMRE

Enzyme Prediction     

No EC number prediction in MGYG000004709_01438.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	10	523	2.2e-180	0.9980916030534351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3533	COG3533	4.37e-162	4	607	11	588	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam07944	Glyco_hydro_127	2.54e-146	10	523	2	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
cd04791	LanC_SerThrkinase	5.65e-04	135	325	94	302	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.
COG4225	YesR	0.003	126	262	42	158	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
COG1331	YyaL	0.010	135	269	418	565	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS96918.1	2.63e-202	5	605	12	626
QHQ63226.1	1.97e-193	5	607	9	625
QOR85903.1	2.68e-166	9	604	13	643
ACE73687.1	1.89e-165	2	604	3	639
AGT32221.1	5.87e-165	9	604	7	637

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	8.33e-167	2	604	9	645	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	3.46e-160	2	604	9	645	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	3.01e-124	2	604	7	623	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
3WRE_A	1.35e-121	59	606	72	658	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	1.84e-121	59	606	72	658	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	7.42e-121	59	606	72	658	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000088	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004709_01438.