CAZyme Information: MGYG000004710_00453

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000004710_00453
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
270	MGYG000004710_125|CGC1	30861.55	4.5458

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004710	1024688	MAG	Spain	Europe

• Gene Location: Start: 1579; End: 2391 Strand: -

Full Sequence      

MQALHHQFVASGRVVRYAPEHYPQFKMGNMDCFILSYAATCDPADVFATQQEMNTMNWYC
SDVQVRGKYPFYAKRFWAENDVELVMEDGDLQDIADGKVDFYSFSYYMSGTVGTHKDHEM
TEGNMTFGGKNPYLESTDWGWQIDPLGLRIALNEIYARYEIPLMVVENGMGAYDEVEEDG
SIHDPYRIAYLQSHVKAMGEAIADGVDLIAYTWWGPIDLVSAGTGEMRKRYGFIHVDKYD
DGTGTYERRRKDSFFAYQKIIKSNGTEGLA

Enzyme Prediction     

No EC number prediction in MGYG000004710_00453.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	1	265	2.9e-67	0.5571095571095571

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	2.06e-100	2	267	209	475	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	4.82e-99	2	267	208	472	cryptic 6-phospho-beta-glucosidase; Provisional
PRK09593	arb	1.08e-97	2	267	210	476	6-phospho-beta-glucosidase; Reviewed
COG2723	BglB	7.28e-97	1	267	193	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK15014	PRK15014	2.09e-84	2	265	211	474	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZH68836.1	2.94e-202	1	269	210	478
ATP54543.1	9.35e-202	1	269	213	481
ADK67798.1	1.47e-157	2	269	213	479
AEB07548.1	3.38e-149	2	269	213	480
QUC04472.1	1.87e-148	2	267	213	478

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	1.89e-92	2	265	203	466	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	2.52e-83	2	265	213	476	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4IPL_A	4.31e-80	2	265	215	482	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
4F66_A	6.28e-78	2	267	212	479	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	1.76e-77	2	267	212	479	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	1.32e-89	2	265	203	466	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P26206	2.99e-84	2	265	198	460	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1
P11988	3.84e-83	2	265	197	459	6-phospho-beta-glucosidase BglB OS=Escherichia coli (strain K12) OX=83333 GN=bglB PE=1 SV=2
Q46829	1.38e-82	2	265	213	476	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
Q48409	2.59e-82	2	265	197	459	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004710_00453.