CAZyme Information: MGYG000004711_01307

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter
• CAZyme ID: MGYG000004711_01307
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
656	MGYG000004711_18|CGC1	75009.77	5.8203

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004711	3563826	MAG	Spain	Europe

• Gene Location: Start: 40140; End: 42110 Strand: +

Full Sequence      

MNKIIVFFCLLGLGTACGKKESLSLGPDYENVLNIKNRPEKVREYLGAFSDLGAWHGFAL
LPDGAESGEGGFAGPLFMAGNVALGPYTAGLEVDIDGKRWIQEAEWMSKVYYPGRLSQSF
RLGEIEVEQDVVFADNRNAIVRSRLTNRGADKRIRLNLKGEYFASHYEVSAVGETGLRFY
MPRRKIYFVLRTEAPYRVNLKDSTYRFSGEEMRLGEGETTENIWVYTATFEGEGERVLER
AFAESESYFRESEARWDGYIRQVFSHPSPLFSELKYRRVAVKCLMTLISNWRSPAQDLLH
NGGYPSYVGFSGGFWSWDSWKIAAGITSFDPELAKDHIRALFDYQLENGMIPDFVSRKKE
YNNLRDTKPPLASWAVGVIFDSDGDLEFVREMYEKLVRYHRWWYSERDHDHNGVCEYGST
DGTLVAAAWESGMDNAVRFDSTRMLKNDLPSAWSTDQESVDLNAYLYDEKLVLARFARLL
GKEEEARVFEKEANRLGTTVRTVMFDKKNGFFSDVKIGTHRPIPGFGPEGWIPLWAGIAD
SVQALSVKNILMDEKHFNSYVPLGTLDISHEKLSPVKGYWRGPVWLDQTYFGLKGLRNYG
YREEARLLTKKVLDHCQGLTGDMPIHENYNPLTGEVLNAPQFGWSAAHLLWMMYEY

Enzyme Prediction     

No EC number prediction in MGYG000004711_01307.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	26	655	2.9e-129	0.9350877192982456

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	2.79e-157	28	654	31	780	alpha-glucosidase; Provisional
COG3408	GDB1	5.19e-20	62	650	19	600	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam01204	Trehalase	3.99e-15	317	656	131	508	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
PLN02567	PLN02567	3.48e-12	369	548	205	429	alpha,alpha-trehalase
COG1626	TreA	7.22e-09	427	613	324	500	Neutral trehalase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT85676.1	5.97e-203	19	655	27	688
AII65461.1	5.97e-203	19	655	27	688
QJR78111.1	5.97e-203	19	655	27	688
QJR61196.1	8.45e-203	28	655	36	688
QJR73960.1	8.45e-203	28	655	36	688

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	2.49e-98	28	655	4	754	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	1.33e-97	28	655	4	754	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	1.86e-97	28	655	4	754	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	1.16e-93	28	649	5	750	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
7PQQ_B	4.66e-48	414	655	26	303	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	2.27e-97	28	655	27	777	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8QTR2	1.37e-24	315	655	98	487	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	3.28e-24	315	655	98	487	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
K5BDL0	2.93e-11	315	650	40	442	Glucosylglycerate hydrolase OS=Mycolicibacterium hassiacum (strain DSM 44199 / CIP 105218 / JCM 12690 / 3849) OX=1122247 GN=ggh PE=1 SV=1
Q9W2M2	6.04e-09	314	645	197	566	Trehalase OS=Drosophila melanogaster OX=7227 GN=Treh PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000034	1.000021	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004711_01307.