CAZyme Information: MGYG000004711_01385

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter
• CAZyme ID: MGYG000004711_01385
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
314	MGYG000004711_20|CGC2	36491.31	9.8676

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004711	3563826	MAG	Spain	Europe

• Gene Location: Start: 32116; End: 33060 Strand: +

Full Sequence      

MKKQLVLIYLCLVLTLANISFLLYYFCFTDKTAFTNRPADRLTFPAEHPVTTDVALPEEM
DFAGEKVPLHRKDVQEALRKELIVNTYLHSHSVQILKNAPRAFAVIEPLLKKAGIPDDFK
YLAVIESNLNPTVVSPAGAVGVWQFMNKTAKEYGLEVNSEVDERYHTEKATLAATRYLRK
AYERFGSWTVAAASYNAGTSMLLKQMNIQQENNYYNLLLGEETERYVFRILALKQILTHP
ERYHFYVPDPYPVEKTRRIKVNGPVEDWTEFAKKHHVSYKTLKRFNPWLRKTKLKNPKRK
TYEIILPANPKLYK

Enzyme Prediction     

No EC number prediction in MGYG000004711_01385.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	103	247	1.8e-26	0.9703703703703703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	3.43e-60	110	235	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	1.15e-26	105	217	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK10783	mltD	3.07e-24	74	287	80	293	membrane-bound lytic murein transglycosylase D; Provisional
cd00254	LT-like	3.13e-20	122	232	5	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13403	MLTF-like	1.62e-14	118	237	11	159	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY32428.1	1.94e-132	1	314	1	311
SNV32652.1	1.94e-132	1	314	1	311
AZS32129.1	1.33e-117	1	314	1	308
QRO51442.1	3.10e-116	1	314	1	308
QGY43333.1	2.74e-97	56	312	48	306

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	7.58e-20	74	286	77	289	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	7.58e-20	74	286	77	289	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.891691	0.102638	0.002837	0.000582	0.000316	0.001945

TMHMM  Annotations     

start	end
5	27