CAZyme Information: MGYG000004711_01554

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter
• CAZyme ID: MGYG000004711_01554
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
518		57554.38	7.0496

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004711	3563826	MAG	Spain	Europe

• Gene Location: Start: 14153; End: 15709 Strand: -

Full Sequence      

MKSKLILTLLLLLFFWSCNDKSTGPAIPVSVGHDIQPVLIRKSENPVLHLEIDNTTGKEI
QLTSVTLSAQGSSTPGNIENVQLYFTGSYPQFRPWVLFGNTQAGTEKIVFNGHQILKPGK
NYFWVSLQLKPETPLDEKIDIQCKKVVLPGYTPRLQTTGDTGKLSVGVAVRMRQDDGCDS
YRIPGLVCTPKGTLIAVYDARWNSSVDLQEDIDVCISRSVDGGQSWLPMQKAIDMKTWGN
KPERENGIGDPAILVDPQTGRLWIAALWLHGHPGERAWWASKPGISPEQTGQFILAYSDD
EGASWSDPINITPQVKKPEWYLCFNGPGMGITTREGVLVFAAQYKDKNQMPYSTIVYSKD
KGKTWHIGTGAKSNTTEAQVVELADGSLMLNMRDNRGGSRSVAVTKDFGKTWTEHTSSRS
ALREPVCQASLIRITSQDGRPALAFFNPDSDKNRNNLSLKLSFDEGKTWPEKYCTLVYKP
DSFGYSCLTQIDSSTLGVLYEGAGDLYFQRINLEEILR

Enzyme Prediction     

EC	3.2.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	171	504	6.2e-97	0.9298245614035088

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	4.93e-103	168	516	1	338	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam14873	BNR_assoc_N	5.72e-27	26	150	1	147	N-terminal domain of BNR-repeat neuraminidase. This domain is usually found at the N-terminus of the BNR-repeat neuraminidase protein family.
pfam13088	BNR_2	5.66e-24	192	490	1	272	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam13859	BNR_3	1.54e-18	183	466	1	271	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4409	NanH	1.72e-12	177	516	271	660	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE51150.1	2.56e-167	37	518	41	519
AEM69599.1	1.31e-162	17	517	22	530
ATA74786.1	1.11e-159	17	518	7	515
AQT68677.1	3.17e-159	29	517	186	676
AGA80527.1	8.12e-158	11	517	4	507

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FJ6_A	1.50e-144	38	517	5	521	Crystalstructure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_B Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_C Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_D Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503]
6MYV_A	7.50e-143	37	518	12	522	Sialidase26co-crystallized with DANA-Gc [bacterium],6MYV_B Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_C Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_D Sialidase26 co-crystallized with DANA-Gc [bacterium]
6MRV_A	1.77e-142	37	518	33	543	Sialidase26co-crystallized with DANA [bacterium],6MRV_B Sialidase26 co-crystallized with DANA [bacterium],6MRX_A Sialidase26 apo [bacterium],6MRX_B Sialidase26 apo [bacterium],6MRX_C Sialidase26 apo [bacterium],6MRX_D Sialidase26 apo [bacterium]
6MNJ_A	1.41e-140	37	518	32	539	Hadzamicrobial sialidase Hz136 [Alistipes],6MNJ_B Hadza microbial sialidase Hz136 [Alistipes]
4Q6K_A	1.50e-139	37	518	15	525	Crystalstructure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_B Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_C Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_D Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P31206	7.77e-147	13	518	10	544	Sialidase OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=nanH PE=3 SV=2
Q02834	2.37e-38	176	513	62	398	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1
P29767	2.25e-33	177	514	391	824	Sialidase OS=Clostridium septicum OX=1504 PE=3 SV=1
P10481	2.21e-28	181	509	36	370	Sialidase OS=Clostridium perfringens OX=1502 GN=nanH PE=1 SV=1
P15698	1.44e-27	151	509	26	388	Sialidase OS=Paeniclostridium sordellii OX=1505 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000021	1.000049	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004711_01554.