CAZyme Information: MGYG000004711_02296

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter
• CAZyme ID: MGYG000004711_02296
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
545	MGYG000004711_46|CGC1	63093.29	9.9104

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004711	3563826	MAG	Spain	Europe

• Gene Location: Start: 19367; End: 21004 Strand: -

Full Sequence      

MIQDRKIHVVILGIVCFFTFFIHNRVIYPDIMESRNLITAREMVQYDNWLVPTMNGVLRL
EKPPLPTWIAAGVEMISPDNVSLQRTAAGIVATLLVFFLYFLAETLTRNRLYGLIASLVL
CTSFNIILMGRTASWDIYCHSFMLGAIYFLYRAFEKPGPCWKEFIGAGIWMGLSFLGKGP
VSFYALLLPFLISYFIFYRPSFRGKWGPLGVLVLICLLISLWWPAYLYLYHRDMALFVAA
KETTAWMERNVRPWYYYWKFFLESGIWSLFLVTALIWPYWKKRLKYKKEYLFTVVWTFSV
LILLSVLPEKKTRYLLPILIPAALVVAHLFLYWTERVRKGGLAGWDKIGFRVNTFLVASV
ALAIPVGVYVLFYAEGYMSTGRLIGVVVLLAGVIYLLFRSALKMRPLQFLAAVVGLFLTV
EIALMPCIANLFNNLERKSIRAVRTIEAVEGLPFYYNADEELRIELVYEAGRRILPWNIR
QDTLPLAHLPIVLVSEKPAAETLPPAILEKVNLRLIDKYDDNRRQKDTKRYSGLFIRYVT
VLEKK

Enzyme Prediction     

No EC number prediction in MGYG000004711_02296.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	5	426	2.5e-60	0.7907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.55e-31	4	419	6	424	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	3.19e-15	1	382	2	374	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	4.91e-12	62	223	2	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	3.01e-06	28	233	27	242	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4346	COG4346	0.008	61	193	135	259	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAT72501.1	9.00e-20	30	476	34	463
ADR19199.1	7.40e-18	33	337	33	335
AMK00316.1	6.62e-17	29	331	31	339
AXJ05197.1	1.93e-16	29	362	52	381
QTD30770.1	1.93e-16	29	362	52	381

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	9.32e-16	23	331	22	321	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
Q3KCC9	2.53e-14	29	362	48	377	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=arnT1 PE=3 SV=1
B4ETL9	3.85e-12	1	364	1	366	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT2 PE=3 SV=1
Q4KC80	8.87e-12	29	423	30	417	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=arnT1 PE=3 SV=1
A4TIM6	8.95e-12	29	366	32	366	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pestis (strain Pestoides F) OX=386656 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000026	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29
81	103
110	132
137	154
175	197
207	229
258	280
290	307
314	333
348	370
383	402
412	434