CAZyme Information: MGYG000004711_02330

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter
• CAZyme ID: MGYG000004711_02330
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
636	MGYG000004711_48|CGC1	73090.63	5.7062

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004711	3563826	MAG	Spain	Europe

• Gene Location: Start: 10447; End: 12357 Strand: +

Full Sequence      

MNVLVGAGLVLLMMACQTSGEKLQDKVLHYPDILNVSYTPESVKGGRGWFTNQGAWMGFT
LPDPGKFTNGFCGPYDLDNRRWISRALVEAGYVDNGKVIAPNAFRPDSLVYFPGKLYMKS
SFPDVTMEQTLFFTDKNHALLICRSNQALNWYFEGNFWDADGKVEMQGKSLLIELPRGEV
AAVTFGADAELMLTSSVYKASYRDCTKQKVVVLSFYNTRQEAETGLTEAKEILAEASARE
NLHRKRWNTYLERTLRPGMPEHYDRIAVKALVTLLSNWRSSKGDLLHDGMVPSHAVGYFV
GFWAWDTWKQAVATVRFEPELAKNQIRSMFDYQDEYGMIADCIYSDKRENNYRDSKPPLA
AWSVMEVFEQTRDTAFVREMYPKLLKYYRWWYQYRDHDGNGICEFGSTDGTEEAAKWESG
MDNAVRFDEAKMVKNREGAWSFNQESVDLNAYLCYEYELLQKMADLCGEKFGEKDRREQV
RGYFFDTKTGYFFDRVLNGDFVRIEGPEGWTPLWSGLASPEQAEKVMKIIADTNKFSTYI
PFPTLAADHPKFLPGGYWRGPIWLDQVYFGISGIRKYGYKAEADTYTDQVFTRLKGISGD
APIHENYDTHDGSVLKAPHFSWSSAHLLMMYWEVNR

Enzyme Prediction     

No EC number prediction in MGYG000004711_02330.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	210	633	3.1e-105	0.5280701754385965

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	3.70e-135	50	631	59	780	alpha-glucosidase; Provisional
COG3408	GDB1	7.81e-20	319	631	302	603	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam01204	Trehalase	4.73e-14	297	612	123	479	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
PLN02567	PLN02567	1.66e-09	319	528	171	432	alpha,alpha-trehalase
pfam03200	Glyco_hydro_63	2.70e-04	374	630	185	492	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQY39153.1	8.26e-233	15	631	21	639
ABR39053.1	8.26e-233	15	631	21	639
QUT86878.1	1.17e-232	15	631	21	639
QJR61716.1	1.17e-232	15	631	21	639
AII67042.1	1.17e-232	15	631	21	639

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	4.67e-84	50	631	32	753	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	2.45e-83	50	631	32	753	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	3.41e-83	50	631	32	753	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	3.63e-79	50	631	33	754	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
6XUX_A	1.05e-39	50	420	358	779	ChainA, Nanobody,Glucosidase YgjK,Glucosidase YgjK,Nanobody [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	3.99e-83	50	631	55	776	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8QTR2	1.80e-21	295	625	90	479	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	4.27e-21	295	625	90	479	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000225	0.296645	0.702815	0.000114	0.000110	0.000097

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004711_02330.