CAZyme Information: MGYG000004711_02557

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter
• CAZyme ID: MGYG000004711_02557
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	MGYG000004711_59|CGC1	43248.35	9.1373

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004711	3563826	MAG	Spain	Europe

• Gene Location: Start: 7253; End: 8392 Strand: +

Full Sequence      

MKYYVIAGEASGDLHASNLMKELKKEDSEAVIRGWGGDFMQEAGCEIVRHYKDTAIMGFV
TVIKNLGKIRENIRLCCEDIQKWQPDVVILVDYAGFNLQVAKFAKSEGIRVFYYISPKLW
AWNTGRVKKIQAYVDRMYVIFPFEEAFYRKFGYPVYYEGNPLMDAIDGRPYPGESFAEFR
AAHSLPDKPIIALLAGSRAQELKHVLPKMLSMVAHFPEYQFVIAGAPSMTDEDYAPFLKD
QRISIVYGQTYRLLSQSHAALVTSGTATLETALLKIPQVVCYSGEGGVFSYFLFKWLVKV
NYISLVNLIMGREVVKELLMQKLNEKNLRRELNAIVTDGPVRKTLLADYEELERRVGKPG
ASHRFAVRMVKDLKQLLYK

Enzyme Prediction     

No EC number prediction in MGYG000004711_02557.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	355	2.9e-116	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	8.57e-113	1	366	2	368	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	7.22e-104	1	373	2	378	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.83e-79	4	344	2	347	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.65e-67	5	366	10	379	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	2.64e-50	1	333	2	314	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY31424.1	1.22e-194	1	377	1	377
SNV26174.1	1.22e-194	1	377	1	377
AZS31618.1	2.58e-189	1	373	1	373
QRO51639.1	5.21e-189	1	373	1	373
BAX81022.1	2.19e-144	1	375	1	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.10e-45	5	356	11	365	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.54e-45	5	356	11	365	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q39T49	4.66e-71	5	366	11	373	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
B6J161	1.00e-67	5	366	8	367	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
A9KC41	1.00e-67	5	366	8	367	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1
Q2LVL8	1.71e-67	5	367	8	372	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q83DS5	1.99e-67	5	366	8	367	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) OX=227377 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004711_02557.