CAZyme Information: MGYG000004712_00604

Basic Information

• Species: Marvinbryantia sp014385005
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Marvinbryantia; Marvinbryantia sp014385005
• CAZyme ID: MGYG000004712_00604
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1263	MGYG000004712_12|CGC1	146428.55	5.5218

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004712	1922596	MAG	China	Asia

• Gene Location: Start: 28741; End: 32532 Strand: +

Full Sequence      

MKTEIGRVVIEDAYAVKDDYDITEAEKKLEEIVTDFPETEYNHKIAQEKNWAVLFSLSHI
RWNAVEWLPVEKKDRVLEIGSQEGSLTGILAEKAGAVTCIEPSTQKCRVNALRNRERENI
EIYNGAYRDVVPQLEEKYDWIFMIGAFEAGRMLMDGTAPYRDLLVSAKELLAPGGSIVIA
SQNRLGLRYFAGCREEYSGKYFGGMEGYREDAQKRTFSRPELEKIIRSAGLEEMQFYYPY
PDYRLPMTIYSDAHLPKVGELWDNLRNFDRERYLMFDESKAFDQIIEDGLFPVFSNSYLV
VIREKKNADTDVKRTIFSKYSNERAAKFAIRTDIQMDGAGRRYARKVACYPEGKDHIDRL
EHWMEALNDAYKGSGMTMNRCRRTEVGIAIDFLTGQTLEEQMDHFLLEGQTEEAIALLMK
YIEVIKKSGSCEQFVVTEEFEKVFGEVLLPEDLTCAKVTDIDMVTGNVICTGDGWIHMDY
EWTFDFPIPVNYVVFRIIQNYLYGNVERSALYKELLYKKAGLTEQEIAQYTCMEQSFQKY
ITGEHIPLRYLYEEISPGCVNFQAEEAHRQEIARANAEANHGIEVFVDTFEIAMTGIHVN
GWAVSKADKQVHFALLDEQNRELDLVKTDYLYRRDVAERFKLSGKSSKAGFRLEFRLPEQ
AQKNRKFTLLAKDSISEVHFLIPVEKLRIKQSRIGKKLMDLRGARDVISYIAPHEMGLFG
EGKAYRVENQRFDTWRMAHRFTEEERVQQEKVTFVRQPEIAVLMHIGEGNERLAEYTRES
LEKQTWKKWKLLTGREAQNLSGMSGDYVLLMEAGDTLEPGAMYEMVKYLNQYPDTQMLYS
DSDKWDPQKKEYFDPQFKPDDSPYTLQSGNYIGNSIWIKKELAERAGGIHPEYGRASVYD
LILRCRELAGSMAHMSRLLYHQNCPMERNLAQRQELVREWEEGKQVLQDYYAKKQIPAQV
TWANFPLRYRVKWQVQGSPKISVIIPNQDHIGDLDQCLRSIAKKSTYSNYEVLVVENNSK
RAETFAYYKKMQKLYSKVRLLTWEKEFNYSAINNFAAKQSEGEYLIFLNNDTEILTEDWM
EEMLSVCQQPDVGVVGSKLYYPDGTIQHAGVILGLSNIAGHLFVKEPGDISGYMGRACTM
QNLSAVTAACMMVSRECFEKVAGFEEILRVALNDVDFCMKVQKIGKQVVYNPEAELYHYE
SKSRGLEDTPEKLERYNREVSYFRNRWGEVLKKGDPYYNVNLSRTTWNCTFRIPPETEKK
GKE

Enzyme Prediction     

No EC number prediction in MGYG000004712_00604.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	982	1161	1.7e-21	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	2.22e-39	983	1200	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd04184	GT2_RfbC_Mx_like	1.92e-33	758	921	1	199	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
COG1216	GT2	1.90e-25	979	1226	3	249	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	7.07e-17	982	1156	1	162	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	3.02e-14	983	1190	1	156	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL24562.1	8.82e-145	804	1252	362	810
QUO33453.1	5.68e-144	725	1243	48	600
QBE99393.1	4.79e-143	725	1252	43	605
QHB25117.1	7.19e-143	559	1253	94	814
QRT31219.1	7.19e-143	559	1253	94	814

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	1.63e-89	805	1243	449	889	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.69e-79	773	1256	364	845	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000017	0.000022	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004712_00604.