CAZyme Information: MGYG000004713_00464

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Anaerovoracaceae; RUG100
• CAZyme ID: MGYG000004713_00464
• CAZy Family: GH13
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
263		30668.75	6.498

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004713	985580	MAG	China	Asia

• Gene Location: Start: 7; End: 798 Strand: +

Full Sequence      

MVTMPPADGGLGFHFKWNMGWMNGVLEYFSTDPLFRKSIHHRLTFSISYAYSENFILPIS
HDEVVHGKHSLLDKMPGTYQEKFSNLRAFYLYMMTHPGKKLVFMGSEWGQFIEWNEKQGL
DWLLLDYPQHKKTQDYVRDINHLYQSLPALWQLDTDYDGFQWIDADNQDDNVYIYCRKDK
EEQLLLCILNLSGNDYKDFHIGVPAATSYRVLLDSDAEKYGGRGVRTKENYAVYSGHQHG
RDNYIRIALPALSAVMLERKGSL

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	2	110	1.6e-52	0.3588039867109635

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05402	PRK05402	1.78e-136	1	261	464	725	1,4-alpha-glucan branching protein GlgB.
PRK12313	PRK12313	5.36e-130	1	263	368	631	1,4-alpha-glucan branching protein GlgB.
TIGR01515	branching_enzym	2.90e-101	1	257	360	617	alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase. This model describes the glycogen branching enzymes which are responsible for the transfer of chains of approx. 7 alpha(1--4)-linked glucosyl residues to other similar chains (in new alpha(1--6) linkages) in the biosynthesis of glycogen. This enzyme is a member of the broader amylase family of starch hydrolases which fold as (beta/alpha)8 barrels, the so-called TIM-barrel structure. All of the sequences comprising the seed of this model have been experimentally characterized. This model encompasses both bacterial and eukaryotic species. No archaea have this enzyme, although Aquifex aolicus does. Two species, Bacillus thuringiensis and Clostridium perfringens have two sequences each which are annotated as amylases. These annotations are aparrently in error. GP|18143720 from C. perfringens, for instance, contains the note "674 aa, similar to gp:A14658_1 amylase (1,4-alpha-glucan branching enzyme (EC 2.4.1.18) ) from Bacillus thuringiensis (648 aa); 51.1% identity in 632 aa overlap." A branching enzyme from Porphyromonas gingivales, OMNI|PG1793, appears to be more closely related to the eukaryotic species (across a deep phylogenetic split) and may represent an instance of lateral transfer from this species' host. A sequence from Arabidopsis thaliana, GP|9294564, scores just above trusted, but appears either to contain corrupt sequence or, more likely, to be a pseudogene as some of the conserved catalytic residues common to the alpha amylase family are not conserved here. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK14705	PRK14705	2.46e-90	2	254	965	1217	glycogen branching enzyme; Provisional
COG0296	GlgB	1.54e-89	1	259	363	628	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSZ27707.1	9.58e-94	1	258	366	624
CBL01646.1	3.15e-93	1	258	375	632
AXB29737.1	2.21e-92	1	258	375	632
ATL90043.1	1.56e-91	1	258	375	632
QSX08640.1	1.99e-91	1	258	371	627

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K1D_A	1.91e-74	2	257	463	719	Crystalstructure of glycogen branching enzyme synonym: 1,4-alpha-D-glucan:1,4-alpha-D-GLUCAN 6-glucosyl-transferase from mycobacterium tuberculosis H37RV [Mycobacterium tuberculosis H37Rv]
6JOY_A	3.03e-74	2	258	364	617	TheX-ray Crystallographic Structure of Branching Enzyme from Rhodothermus obamensis STB05 [Rhodothermus marinus]
5GQZ_A	1.76e-69	2	258	515	772	Crystalstructure of branching enzyme Y500A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GR2_A	4.74e-69	2	258	515	772	Crystalstructure of branching enzyme L541A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GR4_A Crystal structure of branching enzyme L541A mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GQW_A	4.74e-69	2	258	515	772	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8CVY1	8.88e-88	1	258	368	626	1,4-alpha-glucan branching enzyme GlgB OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) OX=373903 GN=glgB PE=3 SV=1
A7GUA1	8.91e-88	1	262	359	625	1,4-alpha-glucan branching enzyme GlgB OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) OX=315749 GN=glgB PE=3 SV=1
C3LC26	2.48e-87	1	262	359	625	1,4-alpha-glucan branching enzyme GlgB OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) OX=568206 GN=glgB PE=3 SV=1
C3PCL8	2.48e-87	1	262	359	625	1,4-alpha-glucan branching enzyme GlgB OS=Bacillus anthracis (strain A0248) OX=592021 GN=glgB PE=3 SV=1
Q81K82	2.48e-87	1	262	359	625	1,4-alpha-glucan branching enzyme GlgB OS=Bacillus anthracis OX=1392 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004713_00464.