CAZyme Information: MGYG000004714_00022

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_X
• CAZyme ID: MGYG000004714_00022
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
400		44968.57	6.256

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004714	2587994	MAG	China	Asia

• Gene Location: Start: 5194; End: 6396 Strand: +

Full Sequence      

MKNGRWILLISIFFLLLLGLCIGQKDKLSFWLSSLKEKREIENQINSMNLDEKVGQLVIS
GFKGETISEELKELIEKSHIGGVILFSSNIKDSNQLIELTNSIKDINSISDGIPIFISVD
QEGGRVSRLPKDIEKFPSAAHIGDHGDENYSYKVGNTLGQVIKTFGFNLNFAPVLDVASN
PENKVIGDRAFGDNEDLVRRMGLQFMNGLRSSNVISVVKHFPGHGDTKEDSHYELPYLNH
HKERLDAIEFVPFKKAIDDGTDGIMVSHIVLKNIDNKNPATMSKAVVTDILRKEFNYEGV
IFTDDINMGAIANNYLLRDAVIKTIDAGVDVIVSSKGVEDTKFIIEIIKDALKKGDISEE
RIKESLNRILKLKYKYSLEDKKLSNINLDKINRFINDNIK

Enzyme Prediction     

No EC number prediction in MGYG000004714_00022.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	112	332	2e-59	0.9537037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	3.23e-92	48	385	1	324	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	3.91e-92	50	372	2	316	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	5.77e-62	64	332	10	277	beta-hexosaminidase; Provisional
PRK15098	PRK15098	7.46e-19	41	378	38	358	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNV85594.1	6.21e-128	41	395	53	406
AUS98755.1	8.92e-128	38	392	60	413
CDI50326.1	1.03e-122	41	392	48	398
AVP54061.1	1.46e-122	35	392	42	398
QAT61223.1	4.02e-122	40	393	44	394

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	1.70e-84	47	379	10	343	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	2.71e-80	38	391	30	411	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	8.33e-80	38	391	4	385	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.67e-79	38	391	34	415	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
4ZM6_A	7.88e-63	46	373	5	337	Aunique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	1.48e-79	38	391	30	411	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	1.63e-59	66	375	50	382	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
Q0AF74	9.78e-43	64	332	12	280	Beta-hexosaminidase OS=Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57) OX=335283 GN=nagZ PE=3 SV=1
Q0A911	1.91e-42	58	350	6	298	Beta-hexosaminidase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) OX=187272 GN=nagZ PE=3 SV=1
Q080R9	1.68e-41	64	332	10	277	Beta-hexosaminidase OS=Shewanella frigidimarina (strain NCIMB 400) OX=318167 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.032663	0.619914	0.346366	0.000351	0.000307	0.000385

TMHMM  Annotations     

start	end
7	24