CAZyme Information: MGYG000004715_01438

Basic Information

• Species: Eubacterium_T saphenum_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Anaerovoracaceae; Eubacterium_T; Eubacterium_T saphenum_A
• CAZyme ID: MGYG000004715_01438
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
241	MGYG000004715_20|CGC1	28122.47	6.4907

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004715	2297538	MAG	China	Asia

• Gene Location: Start: 32324; End: 33049 Strand: -

Full Sequence      

MRIRHQFRLYDIVRLDHFRGFQAYYAIPADSDSALDGHWEKGPGMSFFKYLQQNHCPQNF
IAEDLGFLTEDVHKLIENTGFPGMKVLQFAFDFDYKNQYLPEYYTPNCVVYTGTHDNDTT
RGWYEKLDVWQRGFTANYINDWFRKTFPGEINQKNANAAILNHNISAHLIRTAMASRADT
CIIPLQDWLNLDSDARINTPSTVGGNWAWRLDGDAFQNARNNGLTETMRSLCERYDRLPL
R

Enzyme Prediction     

No EC number prediction in MGYG000004715_01438.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	2	233	2.6e-71	0.44534412955465585

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14508	PRK14508	1.91e-101	2	238	283	497	4-alpha-glucanotransferase; Provisional
pfam02446	Glyco_hydro_77	2.58e-86	2	211	263	457	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
PLN02635	PLN02635	1.34e-72	2	240	309	528	disproportionating enzyme
COG1640	MalQ	8.66e-57	2	237	289	514	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
TIGR00217	malQ	1.52e-46	2	226	297	509	4-alpha-glucanotransferase. This enzyme is known as amylomaltase and disproportionating enzyme. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBE97514.1	3.55e-72	2	219	277	478
QMW79280.1	7.05e-72	2	219	277	478
QIB54765.1	7.05e-72	2	219	277	478
ASU29062.1	1.97e-71	2	216	277	475
ANU76252.1	1.97e-71	2	216	277	475

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2X1I_A	6.14e-51	2	211	279	477	glycosidehydrolase family 77 4-alpha-glucanotransferase from thermus brockianus [Thermus brockianus]
5CPQ_A	3.53e-49	2	238	347	564	Disproportionatingenzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPQ_B Disproportionating enzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPS_A Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPS_B Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPT_A Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CPT_B Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CQ1_A Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CQ1_B Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CSU_A Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSU_B Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSY_A Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana],5CSY_B Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana]
1CWY_A	1.85e-48	2	211	279	477	CrystalStructure Of Amylomaltase From Thermus Aquaticus, A Glycosyltransferase Catalysing The Production Of Large Cyclic Glucans [Thermus aquaticus],1ESW_A X-Ray Structure Of Acarbose Bound To Amylomaltase From Thermus Aquaticus. Implications For The Synthesis Of Large Cyclic Glucans [Thermus aquaticus]
1FP8_A	1.85e-48	2	211	279	477	StructureOf The Amylomaltase From Thermus Thermophilus Hb8 In Space Group P21212 [Thermus thermophilus],1FP9_A Structure Of Amylomaltase From Thermus Thermophilus Hb8 In Space Group C2 [Thermus thermophilus]
2OWC_A	2.78e-47	2	211	282	479	Structureof a covalent intermediate in Thermus thermophilus amylomaltase [Thermus thermophilus],2OWW_A Covalent intermediate in amylomaltase in complex with the acceptor analog 4-deoxyglucose [Thermus thermophilus],2OWX_A THERMUS THERMOPHILUS AMYLOMALTASE AT pH 5.6 [Thermus thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0A3Q0	5.78e-54	2	226	281	488	4-alpha-glucanotransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=malQ PE=3 SV=1
P0A3Q1	5.78e-54	2	226	281	488	4-alpha-glucanotransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=malQ PE=3 SV=1
Q59266	4.91e-51	2	222	271	474	4-alpha-glucanotransferase OS=Clostridium butyricum OX=1492 GN=malQ PE=1 SV=1
Q9LV91	2.29e-48	2	238	359	576	4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic OS=Arabidopsis thaliana OX=3702 GN=DPE1 PE=1 SV=1
O87172	1.01e-47	2	211	279	477	4-alpha-glucanotransferase OS=Thermus thermophilus OX=274 GN=malQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004715_01438.