CAZyme Information: MGYG000004719_00293

Basic Information

• Species: Roseburia sp900756925
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia; Roseburia sp900756925
• CAZyme ID: MGYG000004719_00293
• CAZy Family: GT2
• CAZyme Description: Hyaluronan synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
618		71159.52	5.4078

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004719	2432384	MAG	China	Asia

• Gene Location: Start: 48919; End: 50775 Strand: -

Full Sequence      

MKINVTTIRKGIRYLKHYGWKEFLIRLQEKQEQEAIPYNDWYEKIKPTEAELAEQRKISR
KWKEAPKISIVVPLYNTPETFLREMIESVMASTYENWELCLADGTPGESVIPAIVQKYQQ
NDREIIDNDVSRVVYQKLKENGGIAENTNAAIAMAGGDYIAFLDHDDVITPDALYEMADR
IIKGRKQGKEPEVLYSDEDKTDAGQTKVMDPHFKPDFNPDLLCSNNYITHFLVVKRELAD
RLGGIRKDFDGAQDYDFVLRATEQAKVIAHIPKILYHWRMHELSTAGDGDSKSYARDAGK
RAIEAHLERIGVEGSVEPTKYFGFYRVNYKLTERPLVSIIIPNKDETETLKKCLDAIAKS
SYENYEVIIVENNSTEEATFSLYKKIESDKIRVVYYPDAFNYSKLNNFGASYANGTYYIL
MNNDIEVIETNWIEQMLSNCERREVGVVGARLYYPDNTIQHAGLVVGVGGSLRGIGANLY
QGMRRERSGYMHRAAIQMNYSAVTAALLMVKKEVYDKVNGFEEELSVAFNDVDFCLRVRE
AGYLIVYDPRVEAYHYESKSRGAEDSPEKVARFQSEIEFMRNRWETLLKEGDPNYNLNFS
RMRPDYSLGDPEIMKKQH

Enzyme Prediction     

No EC number prediction in MGYG000004719_00293.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	69	208	4.9e-24	0.7647058823529411
GT2	338	458	2.3e-19	0.7176470588235294

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	4.69e-102	66	280	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	1.41e-38	339	557	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	4.52e-30	334	562	2	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06433	GT_2_WfgS_like	2.87e-24	69	285	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	4.02e-22	69	188	1	110	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL08069.1	3.18e-270	2	610	7	644
CBL12630.1	1.05e-268	2	610	7	644
VCV23340.1	1.61e-268	2	610	19	656
AEN97496.1	7.74e-257	1	610	14	646
QQQ92271.1	1.28e-245	2	608	14	604

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	2.78e-08	336	436	6	105	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
3BCV_A	4.00e-08	66	172	5	100	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	2.30e-135	60	611	360	900	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	2.99e-89	26	608	281	840	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q7BLV3	2.61e-16	33	533	418	864	Hyaluronan synthase OS=Pasteurella multocida OX=747 GN=hyaD PE=1 SV=2
Q9CMP0	1.14e-13	33	286	411	637	Chondroitin synthase OS=Pasteurella multocida (strain Pm70) OX=272843 GN=fcbD PE=3 SV=1
Q58457	2.11e-12	64	280	6	213	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004719_00293.