CAZyme Information: MGYG000004719_00812

Basic Information

• Species: Roseburia sp900756925
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia; Roseburia sp900756925
• CAZyme ID: MGYG000004719_00812
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
798		88137.89	5.4

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004719	2432384	MAG	China	Asia

• Gene Location: Start: 59632; End: 62028 Strand: +

Full Sequence      

MSLKYGEIIKQMSLEEKALMMSGKNTWETVDFEKYGIPSMVMSDGPHGLRRQAGAGDHLG
LNGSLPATCFPTAATIANSWDEKLGEEIGVALAEEAVTMDVNVILGPGLNIKRSPLCGRN
FEYFSEDPYHAGKMAAAYVKGIQSQGISACPKHFAANSQELRRMASDSVVDERTFREIYT
TGFEIAIKEGRSKSIMSSYNEVNGVYANENRHMLQEILVDEWGFEGYVVSDWGGSNDHAL
GVMNGSHLEMPGTGKSGMHDIVRAVKEGTLPEEVLDQRLDELLNVIFATHQATVDGKGKQ
FDIEGHHALARKAAEESVVLLKNKDSILPLKPGTKVAVIGDFAKTPRYQGAGSSLVNPTK
QPEAILDVIGESGLVMTAYEQGYIRNRKSNAALVRAAVEAAKNADVVLVFAGLDEISESE
GLDRTHMHMPQAQNELIDEITAVNSNVVVVLSAGSSIEMPWFDYVKGIVHGYLGGQAGAS
AMMNVLTGKVCPSGKLNETYPLHYEDTPAFHYYPSKERSSEYREALYVGYRYYTTVGKRV
RFPFGYGLSYTKFAYKNLRIEKDGVTFTIENTGSVTGAEVAQLYVGKQSETIFRPVRELK
GFARVTVAPGEEKEVHIPFDDKTFRFYDTRTNTWEVESGTYQIMIGSDAETMVLEGSLEV
EGTVTDGGYSKEILPEYFSGKIENVDDIEYRELYGREIPDGSWSGEIQINDAVCQLYYGK
GIFGKLFYGVLKLLLKISEWQGKPNLNVLFNYNMPIRGYAKMTGGFVTMEMARALTEMAN
GHRIKGTAHLIRAAIKRD

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	33	259	1.2e-64	0.9074074074074074

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.33e-74	68	659	118	763	beta-glucosidase BglX.
COG1472	BglX	8.64e-68	36	371	59	389	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	1.46e-59	8	620	56	743	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	4.63e-50	318	550	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	1.09e-35	36	285	65	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VCV21005.1	0.0	1	798	1	798
CBL11125.1	0.0	1	798	1	798
CBL07402.1	0.0	1	798	1	798
ADL34828.1	0.0	3	791	1	787
BCN29197.1	0.0	3	796	2	796

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	4.14e-216	1	664	1	672	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	9.19e-176	9	662	9	665	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	7.27e-126	4	660	3	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	1.10e-124	4	660	3	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	6.38e-103	7	661	8	837	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	2.27e-215	1	664	1	672	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	1.52e-175	9	662	9	674	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	1.34e-173	9	662	9	674	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	1.09e-129	7	665	48	742	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
Q5BA18	3.64e-121	8	668	16	837	Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglK PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.997112	0.002783	0.000118	0.000005	0.000003	0.000011

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004719_00812.