CAZyme Information: MGYG000004720_00760

Basic Information

• Species: Paramuribaculum sp900759915
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Paramuribaculum; Paramuribaculum sp900759915
• CAZyme ID: MGYG000004720_00760
• CAZy Family: GT113
• CAZyme Description: Beta-1,6-galactofuranosyltransferase WbbI

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364	MGYG000004720_7|CGC1	41145.31	9.7339

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004720	2316857	MAG	China	Asia

• Gene Location: Start: 45240; End: 46334 Strand: -

Full Sequence      

MGNATASFFVNFAIRTNFTTKMPSFYYISRNYKHPGCGGVIARRDIETVLDRMEFENIGL
KPTFSRSGLTHVVRNHIGAMKAARRIKSGDVMVLQYPMSAYFSRICRTARTRGARVVALI
HDLSSFRNKSLTPAQEMALLNQADVLLTHNHRMRQWLAGHGCTVKMIDYEIMDYLEGESS
APHHPEAGRYSIYFVGNLSRAQNAFLYELAAMMPETEFYFYGPEAETAGVPANVRMMGIV
KDTEIIRRHHGDFGISWYGSSLSRAVGRIGEYMEYNNPHKVGLYLRGNSPVIVWKNAGRA
QFIEREGIGVAVGALTELPALLKNLKPEEYAAMLANVERVNRRLAEGYYLQKAMREAFDY
LGIK

Enzyme Prediction     

No EC number prediction in MGYG000004720_00760.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT113	37	357	3.1e-84	0.9658385093167702

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09814	PRK09814	2.83e-63	24	361	2	333	sugar transferase.
cd03794	GT4_WbuB-like	1.69e-07	109	355	119	388	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD43054.1	2.49e-132	27	361	6	342
QQT78203.1	1.07e-81	27	364	4	342
QRP56553.1	1.07e-81	27	364	4	342
ASM65269.1	1.07e-81	27	364	4	342
QUU07104.1	4.26e-81	27	362	4	340

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QKW_A	4.19e-15	86	357	64	325	Structureof Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_B Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_C Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_D Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis]
3RHZ_A	4.44e-15	86	357	72	333	Structureand functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis],3RHZ_B Structure and functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis]
4W6Q_A	7.71e-15	86	357	64	325	GlycosyltransferaseC from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_B Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_C Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_D Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37749	7.40e-32	39	361	15	327	Beta-1,6-galactofuranosyltransferase WbbI OS=Escherichia coli (strain K12) OX=83333 GN=wbbI PE=1 SV=1
B5A7L9	2.25e-14	86	357	62	323	Glucosyltransferase 3 OS=Streptococcus parasanguinis OX=1318 GN=gtf3 PE=1 SV=1
A0A0M3KKZ0	4.15e-14	86	357	62	323	Glucosyltransferase 3 OS=Streptococcus agalactiae serotype III (strain COH1) OX=342616 GN=gtf3 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004720_00760.