CAZyme Information: MGYG000004720_01255

Basic Information

• Species: Paramuribaculum sp900759915
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Paramuribaculum; Paramuribaculum sp900759915
• CAZyme ID: MGYG000004720_01255
• CAZy Family: GH84
• CAZyme Description: Hyaluronoglucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1119	MGYG000004720_14|CGC1	122458.31	4.3971

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004720	2316857	MAG	China	Asia

• Gene Location: Start: 56861; End: 60220 Strand: +

Full Sequence      

MRCFYATLGLMLAFSSAAAAGDYTVYPVPRKVTYTGSSVTITPEVNIVASTSVKANTIDR
LKEVLDENGLKYTESSAPADGMTDIYIGVYGTGDAADIYLAGTFDSSIFPAKAGGYDPHV
LRIAPDADRGVIAILGDEENSAYYACATLEQILEQTDGSTVAGLTVEDFAHARYRGIMEG
FYGHPYSIESRLNLLDYCKRYKLNYYGYGPKADPYHAGNWRLEYPASITDEQRNLGQMTA
DEMRQTAAKAAECNVAFTWIIHPSLGTYYIDLNWVPDIMTKFEHMYDLGIRHFGVSVDDM
SGQPSNQNLLASQVQMQIDTKWNTESTPAKDRVGGILFTPTGYALNYGGASYVLSSLADV
DSKIDVAFTGYDCFSNVRASSFATMADLVQRDPVFWWNNPVNDDYDGFLYLHGLTARWTI
EQQGAVPHMKGFLLNPMNQGQASKICLFSGADYAWNPEAFDADRSWQASLYSIVKTDEYA
EPLRKFIDVVSAYVTKDTQTPEGEKYASLYNDFKNSYPSTSFATAQELYTAMADACDACA
KLRELKDSDDPDCRLFYADIEPWLLKVEDMTGIVRGTFDLIEGKGDLDRWTDYNDLAERA
SKIHSAHTFSVLEGSGLTTYETFREAQPTPKDLDALIDFLASRISGLALQLPQRSRVPEI
ITNIDPAPASATLTSDDASGAYTLSGLSAATLKPGEYIGINLNRYQSADISPIQGTASSD
VVLQHSVNGKSWTNYTPGRETLPLTYFRLRNISRSDATAAGDSFTFTPASESSSSELSLS
VSTNMPVYSTYAIENVIDGNNSTFFWSDGVPEAGSSYIMIDLGTTAIVSGTDFCFNSGDQ
PSGQCSIEVSSDRVNWHEAATFAKADISDRRLSLSFSPARCRYVRMLITSTTTNEWLQIA
EFSVRATVESTGSSLALAVAEDNRGSMIESLDDRRLTTYYQPEGEGHLIYTFTENLKFDE
IHVYHNSAFSPDAEAPRVSIFADGDWHELGTLDAVRSKFPTADYTDISLMRIDWNETNRP
VLHEIIPVGTTYVEPAGSTSAVDTPAAGHAIAIEISGRDITVNASADADLTVTVTDTAGR
ITARVQGTAPLLLTAPQGVAIVTVTAPGLKPHTAKHLIP

Enzyme Prediction     

No EC number prediction in MGYG000004720_01255.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	175	487	4.7e-67	0.9932203389830508
CBM32	788	903	1.4e-16	0.8790322580645161

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	1.69e-104	175	486	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam02838	Glyco_hydro_20b	4.76e-15	22	168	1	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
pfam00754	F5_F8_type_C	8.32e-10	786	902	7	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT77745.1	3.66e-314	11	1034	9	1025
BCI64753.1	3.20e-223	8	1041	8	1039
AHF13697.1	1.89e-221	20	1043	22	1038
AHF13792.1	4.73e-174	18	1062	4	1186
QFQ11845.1	3.42e-104	8	1025	8	1042

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PWI_A	2.81e-60	11	482	21	464	Structureof CpGH84D [Clostridium perfringens ATCC 13124],6PWI_B Structure of CpGH84D [Clostridium perfringens ATCC 13124]
5MI4_A	3.36e-52	132	596	101	542	BtGH84mutant with covalent modification by MA3 [Bacteroides thetaiotaomicron VPI-5482],5MI5_A BtGH84 mutant with covalent modification by MA3 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],5MI6_A BtGH84 mutant with covalent modification by MA3 in complex with Thiamet G [Bacteroides thetaiotaomicron VPI-5482],5MI7_A BtGH84 mutant with covalent modification by MA4 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482]
2J4G_A	6.98e-52	132	596	89	530	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482],2J4G_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482]
2J47_A	7.07e-52	132	596	90	531	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with a imidazole-pugnac hybrid inhibitor [Bacteroides thetaiotaomicron VPI-5482],2W4X_A BtGH84 in complex with STZ [Bacteroides thetaiotaomicron VPI-5482],2W66_A BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W66_B BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W67_A BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2W67_B BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2WCA_A BtGH84 in complex with n-butyl pugnac [Bacteroides thetaiotaomicron VPI-5482],2XJ7_A BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XJ7_B BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XM1_A BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM1_B BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM2_A BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],2XM2_B BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],4UR9_A Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],4UR9_B Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],5FKY_A Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FKY_B Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FL0_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL0_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron]
2JIW_A	7.07e-52	132	596	90	531	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482],2JIW_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26831	7.83e-52	23	904	39	943	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
Q89ZI2	5.02e-51	132	596	111	552	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q0TR53	3.55e-43	27	543	48	540	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	4.36e-42	27	543	48	540	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
O60502	6.62e-15	176	453	63	331	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000250	0.999096	0.000145	0.000173	0.000153	0.000145

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004720_01255.