CAZyme Information: MGYG000004720_01746

Basic Information

• Species: Paramuribaculum sp900759915
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Paramuribaculum; Paramuribaculum sp900759915
• CAZyme ID: MGYG000004720_01746
• CAZy Family: GH20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
651		72487.54	5.0988

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004720	2316857	MAG	China	Asia

• Gene Location: Start: 12284; End: 14239 Strand: +

Full Sequence      

MNRITKSLCSLVALVAGTLSLPAAVGSPSDIIPRPTEILPAKGVYTLPAGFSPADVKQKI
TGKGGEGYQLKITPKGITVTAGSEAGAYYAVQSLRQMISGDSITALECCTVNDSPRFPYR
GLHFDVSRHFRSVDFLKKQIDAMALMKLNKLHLHFTDGAGWRMQIDRYPRLTEFAAWRPQ
AKWSDWTANGAKYCESTDPNAAGGFYTKEELRDLIDYAAGHHITIIPEIEMPGHSEEVLA
AYPELSCTGEQYGSSDLCPGKEATFEFLQNVLDEVIEVFPSHYIHIGGDEASKARWRDCP
DCQARIKAENLDGVDGLQSYLIHRIEKYLNSKGRSIIGWDEILEGGVAPNATVMSWRGTE
GGIRSLKSGHDVVMTPGEFCYIDYCQDAPFREPESIGGYTPLAKVYSYEPVEPGLTEEDA
SHLLGVQANLWAEYVPADSHAEYMYYPRTYAIAEIGWSTPEKNYDDFHRRALLLNERMIA
DGYTPFDLANEYGERRESLTAVDHAGRGAKVTYASPYNQKYTAAGDATLTDGIRGGWTYG
DRRWQGFSRDVDLTVDLGEVKPVNYVGADFMHSYGAWVHLPDFVEISTSEDGKNFSEPVV
IWNDVDATYPKIMFKNYGTAFADTKARYIRLKAKQNPRPGAWLFMDEIVIN

Enzyme Prediction     

No EC number prediction in MGYG000004720_01746.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	112	459	1.5e-116	0.973293768545994

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06563	GH20_chitobiase-like	0.0	117	471	1	357	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
pfam00728	Glyco_hydro_20	2.10e-160	117	458	1	344	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
COG3525	Chb	4.89e-116	41	470	183	627	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
cd06568	GH20_SpHex_like	9.53e-91	117	470	1	328	A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex). SpHex catalyzes the hydrolysis of N-acetyl-beta-hexosaminides. An Asp residue within the active site plays a critical role in substrate-assisted catalysis by orienting the 2-acetamido group and stabilizing the transition state. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself. Proteins belonging to this subgroup lack the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases.
cd06570	GH20_chitobiase-like_1	4.60e-86	117	470	1	310	A functionally uncharacterized subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the chitobiase of Serratia marcescens, a beta-N-1,4-acetylhexosaminidase that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This subgroup lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL06341.1	5.89e-261	66	650	115	700
QRO24953.1	2.47e-239	66	650	103	687
QKH84207.1	5.67e-236	66	650	101	689
BCI64750.1	1.51e-235	66	650	102	687
QCQ51286.1	3.24e-235	66	650	101	689

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q63_A	2.86e-153	66	651	106	774	BT0459[Bacteroides thetaiotaomicron],6Q63_B BT0459 [Bacteroides thetaiotaomicron],6Q63_C BT0459 [Bacteroides thetaiotaomicron]
3RCN_A	1.71e-96	66	470	78	497	CrystalStructure of Beta-N-Acetylhexosaminidase from Arthrobacter aurescens [Paenarthrobacter aurescens TC1]
7CBN_A	4.79e-94	64	470	76	495	Crystalstructure of beta-N-acetylhexosaminidase Am0868 from Akkermansia muciniphila [Akkermansia muciniphila ATCC BAA-835],7CBO_A Crystal structure of beta-N-acetylhexosaminidase Am0868 from Akkermansia muciniphila in complex with GlcNAc [Akkermansia muciniphila ATCC BAA-835]
6EZR_A	2.34e-75	68	467	211	616	Crystalstructure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZR_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZS_A Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6EZS_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6K35_A Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi],6K35_B Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi]
7DUP_A	1.70e-74	66	470	79	505	ChainA, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_A Chain A, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_B Chain B, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49008	3.95e-112	66	613	111	675	Beta-hexosaminidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=nahA PE=3 SV=2
B2UQG6	3.54e-93	64	470	95	514	Beta-hexosaminidase Amuc_0868 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_0868 PE=1 SV=1
P96155	5.28e-75	68	459	210	607	Beta-hexosaminidase OS=Vibrio furnissii OX=29494 GN=exoI PE=1 SV=1
B2UP57	3.95e-69	66	470	58	461	Beta-hexosaminidase Amuc_2018 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_2018 PE=1 SV=1
Q04786	2.61e-53	68	472	267	730	Beta-hexosaminidase OS=Vibrio vulnificus OX=672 GN=hex PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000591	0.998587	0.000238	0.000212	0.000177	0.000160

TMHMM  Annotations     

start	end
7	26