CAZyme Information: MGYG000004720_01842

Basic Information

• Species: Paramuribaculum sp900759915
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Paramuribaculum; Paramuribaculum sp900759915
• CAZyme ID: MGYG000004720_01842
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
313		35875.7	6.9744

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004720	2316857	MAG	China	Asia

• Gene Location: Start: 21280; End: 22221 Strand: -

Full Sequence      

MTHRNSVIRTIILTALLALTVTVVPASGKTPSAVVNPRVPEKVKFAGQSVSTDREDMYER
LDRELTAMAYTHGNTLLTIKRANRYFPVIMPILKANGVPADLAYLACIESYLNPRAYSGA
KAAGIWQFMPSTAKEYGLEVNDYVDERYHLEKATEAACRYLKAAYSRYGNWESAAAAYNG
GNGRITRELEAQQAESAYDLYLTDETSRYMFRLLAMKLIMEHPSHYGFHLEEDQLYQPME
FTEVAVSEPVEDWPQWAIDHGIDYLTLREANPWIRAKSLPNKEGKTYMVRIPAEESLYRS
RQHRKTYNHDWVR

Enzyme Prediction     

No EC number prediction in MGYG000004720_01842.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	91	217	1.7e-23	0.837037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	9.76e-62	93	217	1	128	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	2.75e-27	88	187	1	101	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK10783	mltD	3.09e-27	53	245	76	278	membrane-bound lytic murein transglycosylase D; Provisional
cd00254	LT-like	2.27e-16	109	187	11	87	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PHA00368	PHA00368	1.78e-12	95	214	21	139	internal virion protein D

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD43280.1	5.28e-148	32	312	46	326
QCD35372.1	4.20e-146	10	312	23	331
ASB38769.1	7.46e-144	32	312	39	319
QQR09511.1	7.46e-144	32	312	39	319
ANU63153.1	7.46e-144	32	312	39	319

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	1.55e-22	53	289	73	306	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	1.55e-22	53	289	73	306	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
P32820	1.57e-13	75	189	15	130	Putative tributyltin chloride resistance protein OS=Alteromonas sp. (strain M-1) OX=29457 GN=tbtA PE=3 SV=1
O31608	1.44e-06	109	187	85	158	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002171	0.994844	0.002286	0.000261	0.000200	0.000182

TMHMM  Annotations     

start	end
7	26